DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13527 and CG12951

DIOPT Version :9

Sequence 1:NP_001286744.1 Gene:CG13527 / 37615 FlyBaseID:FBgn0034776 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_649880.1 Gene:CG12951 / 41110 FlyBaseID:FBgn0037677 Length:265 Species:Drosophila melanogaster


Alignment Length:273 Identity:66/273 - (24%)
Similarity:114/273 - (41%) Gaps:44/273 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LITVMVILSGAHRMKRLSSPKFHGDETLELAKYVVSIRSRTPNKYFGDNHYCGGGLLSNQWVITA 75
            ||.::.:.:.......:|......|.::....:|||:||      :..:|.|||.::|..:|:||
  Fly    11 LIVILAVTTVGQAAPSISRVVNGTDSSVLKYPFVVSLRS------YDGSHSCGGSIISKHFVMTA 69

  Fly    76 AHCVMGQSKIMYKARWLLVVAGSPHRLRYTPGKSVCSP----VSSLYVPKNF--TMHNTFNMALM 134
            |||..|:     .|..|.:..|       ....|...|    :..:...::|  |..|..:::|:
  Fly    70 AHCTNGR-----PADTLSIQFG-------VTNISAMGPNVVGIKKIIQHEDFDPTRQNANDISLL 122

  Fly   135 KLQEKMPSNDPRIGFLHLPKEAPKI-----GIRHTVLGWGRMYFGGPLAVHIYQVDVVLMDNAVC 194
            .::|....:...:..:.||..|..:     |:...::|||.....|.:...:.:|.:.:..:..|
  Fly   123 MVEEPFEFDGVSVAPVELPALAFAVPQSDAGVEGVLIGWGLNDTYGSVQDTLQEVSLKIYSDEEC 187

  Fly   195 KTYFRHYGDG----MMCAGNNNWTID---AEPCSGDIGSPLLSGKVVVGIVAYPI-GCGCTNIPS 251
            .:  ||.|..    .:|.|     :|   ...||||.|.||:.....||||::.| .|.....|.
  Fly   188 TS--RHNGQTDPKYHICGG-----VDEGGKGQCSGDSGGPLIYNGQQVGIVSWSIKPCTVAPYPG 245

  Fly   252 VYTDVFSGLRWIR 264
            ||..|...:.||:
  Fly   246 VYCKVSQYVDWIK 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13527NP_001286744.1 Tryp_SPc 43..266 CDD:238113 62/241 (26%)
Tryp_SPc 43..263 CDD:214473 60/238 (25%)
CG12951NP_649880.1 Tryp_SPc 29..257 CDD:214473 61/252 (24%)
Tryp_SPc 30..260 CDD:238113 63/254 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456127
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.