DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13527 and CG13318

DIOPT Version :9

Sequence 1:NP_001286744.1 Gene:CG13527 / 37615 FlyBaseID:FBgn0034776 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_649831.1 Gene:CG13318 / 41048 FlyBaseID:FBgn0037627 Length:405 Species:Drosophila melanogaster


Alignment Length:236 Identity:77/236 - (32%)
Similarity:112/236 - (47%) Gaps:36/236 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 TPNKYFGDNHYCGGGLLSNQWVITAAHCVMGQSKIMYKAR---WLLVVAGSPHRLRYTPGKSVCS 112
            |.:.|.|     ||.|::.|.|:||||.|.......:|.|   |.......|     .|.:.|. 
  Fly   183 TADVYLG-----GGALITAQHVLTAAHKVYNLGLTYFKVRLGEWDAASTSEP-----IPAQDVY- 236

  Fly   113 PVSSLYVPKNFTMHNTFN-MALMKLQEKMP-SNDPRIGFLHLPKEAPKIGIRHTVLGWGRMYFGG 175
             :|::||..:|..:|..| :|::||...:. ::...:|.:.||..: .:|.|..|.|||:..||.
  Fly   237 -ISNVYVNPSFNPNNLQNDVAILKLSTPVSLTSKSTVGTVCLPTTS-FVGQRCWVAGWGKNDFGA 299

  Fly   176 PLAVHIY--QVDVVLMDNAVCKTYFRHYGDG---------MMCAGNNNWTIDAEPCSGDIGSPLL 229
            ..|....  ||||.|:.||.|:...:....|         .:|||..   ...:.|:||.||||:
  Fly   300 TGAYQAIERQVDVPLIPNANCQAALQATRLGSSFVLSPTSFICAGGE---AGKDACTGDGGSPLV 361

  Fly   230 --SGKV--VVGIVAYPIGCGCTNIPSVYTDVFSGLRWIRHT 266
              |..|  |||:||:.|||....:|.||.:|.:.|.||:.|
  Fly   362 CTSNGVWYVVGLVAWGIGCAQAGVPGVYVNVGTYLPWIQTT 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13527NP_001286744.1 Tryp_SPc 43..266 CDD:238113 76/234 (32%)
Tryp_SPc 43..263 CDD:214473 74/231 (32%)
CG13318NP_649831.1 Tryp_SPc 169..402 CDD:238113 76/234 (32%)
Tryp_SPc 169..399 CDD:214473 74/231 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.