DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13527 and MP1

DIOPT Version :9

Sequence 1:NP_001286744.1 Gene:CG13527 / 37615 FlyBaseID:FBgn0034776 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_001303421.1 Gene:MP1 / 40541 FlyBaseID:FBgn0027930 Length:400 Species:Drosophila melanogaster


Alignment Length:276 Identity:71/276 - (25%)
Similarity:113/276 - (40%) Gaps:64/276 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 GDETLELA-KYVVSIRSRTPNKYFGDNHYCGGGLLSNQWVITAAHCVMGQSKIMYKARWLLV--- 94
            |:||.:.. .::..|....|....|  |:|||.|:::::|:||||||..     ..:.|.|.   
  Fly   141 GNETTKREFPWMALIEYTKPGNVKG--HHCGGSLINHRYVLTAAHCVSA-----IPSDWELTGVR 198

  Fly    95 -----VAGSPHRLRYTPGKSVCSPVSSLYV-------------PKNFTMHNTFNMALMKLQEKMP 141
                 .:.:|.   .|.||:.....:..||             |.| :.....::||::|::::.
  Fly   199 LGEWDASTNPD---CTVGKNGRRDCNEPYVDYPVEERIPHPQYPGN-SRDQLNDIALLRLRDEVQ 259

  Fly   142 SNDPRIGFLHLPKEAPKIGIRH---------TVLGWGRMYFGGPLAVHIYQVDVVLMDNAVCK-- 195
            .:|    |: ||...|.:..:|         .|.||||........:.: :.::..:..:.|.  
  Fly   260 YSD----FI-LPVCLPTLASQHNNIFLGRKVVVAGWGRTETNFTSNIKL-KAELDTVPTSECNQR 318

  Fly   196 --TYFRHYGDGMMCAGNNNWTIDAEPCSGDIGSPLL--------SGKVVVGIVAY-PIGCGCTNI 249
              |..|......||||.   ....:.|.||.|.|||        |...:.|:|:| |..||....
  Fly   319 YATQRRTVTTKQMCAGG---VEGVDSCRGDSGGPLLLEDYSNGNSNYYIAGVVSYGPTPCGLKGW 380

  Fly   250 PSVYTDVFSGLRWIRH 265
            |.|||.|.:.|.||.:
  Fly   381 PGVYTRVEAYLNWIEN 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13527NP_001286744.1 Tryp_SPc 43..266 CDD:238113 68/266 (26%)
Tryp_SPc 43..263 CDD:214473 66/262 (25%)
MP1NP_001303421.1 CLIP 29..91 CDD:288855
Tryp_SPc 137..394 CDD:214473 69/272 (25%)
Tryp_SPc 138..397 CDD:238113 71/276 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.