DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13527 and CG7542

DIOPT Version :9

Sequence 1:NP_001286744.1 Gene:CG13527 / 37615 FlyBaseID:FBgn0034776 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_001287099.1 Gene:CG7542 / 39960 FlyBaseID:FBgn0036738 Length:270 Species:Drosophila melanogaster


Alignment Length:245 Identity:60/245 - (24%)
Similarity:99/245 - (40%) Gaps:63/245 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 NKYFGD-NHYCGGGLLSNQWVITAAHCV--------------------MGQSKIMYKARWLLVVA 96
            |..||: :.:|||.|:|:.|:||||||:                    .||.:||.:.       
  Fly    45 NVSFGNWSTWCGGTLISHYWIITAAHCMDGAESVTVYLGAINIGDESEEGQERIMVEK------- 102

  Fly    97 GSPHRLRYTPGKSVCSPVSSLYVPKNFTMHNTFN-MALMKLQEKMPSNDPRIGFLHLPK----EA 156
                              |.:.|..|:......| ::|::|...:...| ||....||:    :.
  Fly   103 ------------------SGIIVHSNYMASTVVNDISLIRLPAFVGFTD-RIRAASLPRRLNGQF 148

  Fly   157 PKI-GIRHTVLGWGRMYFGGPLAVHIYQ-VDVVLMDNAVCKTYFR-HYGDGMMCAGNNNWTIDAE 218
            |.. .||....||||..........:.: |::.:|.:::|:.|:. ...:.|:|...   |....
  Fly   149 PTYESIRAFASGWGRESDASDSVSPVLRYVEMPIMPHSLCRMYWSGAVSEKMICMST---TSGKS 210

  Fly   219 PCSGDIGSPLL----SGKVVVGIVAYPIGCGC-TNIPSVYTDVFSGLRWI 263
            .|.||.|.||:    :...::|..::....|| ...|:|:|.:.|.|.||
  Fly   211 TCHGDSGGPLVYKQGNSSYLIGSTSFGTSMGCQVGFPAVFTRISSYLDWI 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13527NP_001286744.1 Tryp_SPc 43..266 CDD:238113 60/245 (24%)
Tryp_SPc 43..263 CDD:214473 58/243 (24%)
CG7542NP_001287099.1 Tryp_SPc 27..263 CDD:238113 60/245 (24%)
Tryp_SPc 27..260 CDD:214473 58/243 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.