DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13527 and Jon74E

DIOPT Version :9

Sequence 1:NP_001286744.1 Gene:CG13527 / 37615 FlyBaseID:FBgn0034776 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster


Alignment Length:251 Identity:61/251 - (24%)
Similarity:110/251 - (43%) Gaps:50/251 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 ELAK-----YVVSIRSRTPNKYFGDNHYCGGGLLSNQWVITAAHCVMGQSKIMYKARWLLVVAGS 98
            |||:     |.|.:....||..:   .:||..|:|:::::||||||.....|.|      .:.|.
  Fly    36 ELARANQFPYQVGLSIEEPNDMY---CWCGASLISDRYLLTAAHCVEKAVAITY------YLGGV 91

  Fly    99 PHRLRYTPGKSVCSPVSSLYVPKNFTMHNTFN-MALMKLQE-----------KMPS-NDPRIGFL 150
               ||..|.:.:.|....:::..::...:..| :||::|.|           ::|. :..|..:.
  Fly    92 ---LRLAPRQLIRSTNPEVHLHPDWNCQSLENDIALVRLPEDALLCDSIRPIRLPGLSSSRNSYD 153

  Fly   151 HLPKEAPKIGIRHTVLGWGRMY-FGGPLAVHIYQVDVVLMDNAVCKTYFRHYGDGMMCAGNNNWT 214
            ::|..|.         |||||. ....::.::..|...:..|..|:..:.:.....:|.   :.|
  Fly   154 YVPAIAS---------GWGRMNDESTAISDNLRYVYRFVESNEDCEYSYANIKPTNICM---DTT 206

  Fly   215 IDAEPCSGDIGSPLL------SGKVVVGIVAYPIGCGCT-NIPSVYTDVFSGLRWI 263
            .....|:||.|.||:      :..:::|:.:|....||| ..|||:|.:.:.|.||
  Fly   207 GGKSTCTGDSGGPLVYSDPVQNADILIGVTSYGKKSGCTKGYPSVFTRITAYLDWI 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13527NP_001286744.1 Tryp_SPc 43..266 CDD:238113 58/242 (24%)
Tryp_SPc 43..263 CDD:214473 56/240 (23%)
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 59/249 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.