DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13527 and CG4998

DIOPT Version :9

Sequence 1:NP_001286744.1 Gene:CG13527 / 37615 FlyBaseID:FBgn0034776 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_001036609.1 Gene:CG4998 / 39808 FlyBaseID:FBgn0036612 Length:1185 Species:Drosophila melanogaster


Alignment Length:262 Identity:74/262 - (28%)
Similarity:125/262 - (47%) Gaps:38/262 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 RLSSPKF-HGDETLELAKYVVSIRSRTPNKYFGDNHYCGGGLLSNQWVITAAHCVMGQSKIMYKA 89
            |:.:|.: .||.......:.|:|..:.|.:..   :.|||.|:..|.:|:||||:..|:....:.
  Fly   932 RIKNPVYVDGDSEFGEYPWHVAILKKDPKESI---YACGGTLIDAQHIISAAHCIKSQNGFDLRV 993

  Fly    90 R---WLLVVAGSPHRLRYTPGKSVCSPVSSLYVPKNF---TMHNTFNMALMKLQEKMP-SNDPRI 147
            |   |     ...|.:.:.|  .:...|.|:::...:   |:.|  ::|::||.:.:. :.:|.|
  Fly   994 RLGEW-----DVNHDVEFFP--YIERDVVSVHIHPEYYAGTLDN--DLAVLKLDQPVDFTKNPHI 1049

  Fly   148 GFLHLP-KEAPKIGIRHTVLGWGRMYFG--GPLAVHIYQVDVVLMDNAVCKTYFRH--------Y 201
            ....|| |.:...|.|....|||:..||  |.....:.:|||.::.:..|::..|:        .
  Fly  1050 SPACLPDKYSDFTGARCWTTGWGKDAFGEHGKYQNILKEVDVPILSHQQCESQLRNTRLGYSYKL 1114

  Fly   202 GDGMMCAGNNNWTIDAEPCSGDIGSPLL---SGKV-VVGIVAYPIGCGCTNIPSVYTDVFSGLRW 262
            ..|.:|||...   ..:.|.||.|.||:   :|.: |||:|::.||||..|:|.||..|.:.|.|
  Fly  1115 NPGFVCAGGEE---GKDACKGDGGGPLVCDRNGAMHVVGVVSWGIGCGQVNVPGVYVKVSAYLPW 1176

  Fly   263 IR 264
            |:
  Fly  1177 IQ 1178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13527NP_001286744.1 Tryp_SPc 43..266 CDD:238113 70/244 (29%)
Tryp_SPc 43..263 CDD:214473 68/241 (28%)
CG4998NP_001036609.1 Tryp_SPc 942..1180 CDD:238113 71/252 (28%)
Tryp_SPc 942..1177 CDD:214473 69/249 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456149
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.