DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13527 and CG11529

DIOPT Version :9

Sequence 1:NP_001286744.1 Gene:CG13527 / 37615 FlyBaseID:FBgn0034776 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_648558.1 Gene:CG11529 / 39395 FlyBaseID:FBgn0036264 Length:287 Species:Drosophila melanogaster


Alignment Length:225 Identity:69/225 - (30%)
Similarity:100/225 - (44%) Gaps:51/225 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 CGGGLLSNQWVITAAHCVMGQSKIMYKARWLLVVAGSPHRLRYTPGKSV-CSPVSSLYVPKN--F 123
            |||.||..:|::||.||.||.:                |...|...||| .:.||...|.::  |
  Fly    59 CGGTLLDKRWILTAGHCTMGVT----------------HYDVYLGTKSVEDTEVSGGLVLRSNKF 107

  Fly   124 TMHNTFN-------MALMKLQEKMPSNDPRIGFLHLP---KEAPKIGIRHTVLGWGRMYFGGPLA 178
            .:|..||       :||:||.:.: :..|||....||   :.....|:.....|||.|       
  Fly   108 IVHERFNPETAANDIALVKLPQDV-AFTPRIQPASLPSRYRHDQFAGMSVVASGWGAM------- 164

  Fly   179 VHIYQVD------VVLMDNAVCKTYFRHYGDGMMCA-GNNNWTIDAEPCSGDIGSPLL--SGKVV 234
            |.:...|      :.::.||.|...:.....|::|| |..:.|:    |:||.|.||:  ..::|
  Fly   165 VEMTNSDSMQYTELKVISNAECAQEYDVVTSGVICAKGLKDETV----CTGDSGGPLVLKDTQIV 225

  Fly   235 VGIVAYPIGCGC-TNIPSVYTDVFSGLRWI 263
            |||.::....|| ||||..:|.|...|.||
  Fly   226 VGITSFGPADGCETNIPGGFTRVTHYLDWI 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13527NP_001286744.1 Tryp_SPc 43..266 CDD:238113 69/225 (31%)
Tryp_SPc 43..263 CDD:214473 67/223 (30%)
CG11529NP_648558.1 Tryp_SPc 37..258 CDD:238113 69/225 (31%)
Tryp_SPc 37..255 CDD:214473 67/223 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.