DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13527 and CG18180

DIOPT Version :9

Sequence 1:NP_001286744.1 Gene:CG13527 / 37615 FlyBaseID:FBgn0034776 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_648341.1 Gene:CG18180 / 39125 FlyBaseID:FBgn0036024 Length:264 Species:Drosophila melanogaster


Alignment Length:248 Identity:64/248 - (25%)
Similarity:95/248 - (38%) Gaps:61/248 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 AKYVVSIRSRTPNKYFGDNHYC--GGGLLSNQWVITAAHCVMGQ-SKIMYKARWLLVVAGSPHRL 102
            |.|:|.:..||.    |.|...  .|.:::|.|::|||||:.|. .:|.|.:.|     |.....
  Fly    47 APYIVGLFIRTD----GSNSGAVGAGTIIANDWILTAAHCLTGDYVEIHYGSNW-----GWNGAY 102

  Fly   103 RYTPGKSVCSPVSSLYVPKNFTMHNTFNMALMKLQEKMPSNDPR-IGFLHLPK----------EA 156
            |.|..:.            ||..|..:           ||...| ||.:..|.          ..
  Fly   103 RQTVRRD------------NFISHPDW-----------PSQGGRDIGLIRTPHVDFNGLINKIPL 144

  Fly   157 PKIGIRH--------TVLGWGRMYFGGPLAVHIYQVDVVLMDNAVCKTYFRHYGDGMMCAGNNNW 213
            |.:..::        ...|||.| ..|.||..:..|||.::.|:.|:..:.......||..:.: 
  Fly   145 PSMNEQNDRYQDTWCVACGWGGM-DNGNLADWLQCVDVQIISNSECEQAYGSVASTDMCTRHAD- 207

  Fly   214 TIDAEPCSGDIGSPLLS--GKVVVGIVAYPIGCGCTNIPSVYTDVFSGLRWIR 264
              ....|.||.|.||::  ...:||::.: ....|.:.||.||.|...|.|||
  Fly   208 --GKSVCGGDSGGPLVTHDNARLVGVITF-ASVSCHDGPSGYTRVSDYLEWIR 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13527NP_001286744.1 Tryp_SPc 43..266 CDD:238113 63/246 (26%)
Tryp_SPc 43..263 CDD:214473 60/243 (25%)
CG18180NP_648341.1 Tryp_SPc 35..256 CDD:214473 61/245 (25%)
Tryp_SPc 36..259 CDD:238113 64/248 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.