Sequence 1: | NP_001286744.1 | Gene: | CG13527 / 37615 | FlyBaseID: | FBgn0034776 | Length: | 292 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001033949.1 | Gene: | CG33460 / 3885588 | FlyBaseID: | FBgn0053460 | Length: | 275 | Species: | Drosophila melanogaster |
Alignment Length: | 248 | Identity: | 45/248 - (18%) |
---|---|---|---|
Similarity: | 76/248 - (30%) | Gaps: | 97/248 - (39%) |
- Green bases have known domain annotations that are detailed below.
Fly 61 YCGGGLLSNQWVITAAHCVMGQSKIMYKARWLLVVAGSPHRLRYTPGKSVCSPVSSLYVPKN--- 122
Fly 123 --FTMHNTFNMALMKLQEKMPSNDPRIGFLHLPKEAPKIGIRHTVLGWGRMYFGGPLAVHIYQVD 185
Fly 186 VVLMDNAVCKTYFRHYGDGMM--------------------------------CAGNNNWTIDAE 218
Fly 219 PCSGDIGSPLLSGKVVVGIVAYPIGCGCTNIPSV-------YTDVFSGLRWIR 264 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG13527 | NP_001286744.1 | Tryp_SPc | 43..266 | CDD:238113 | 45/248 (18%) |
Tryp_SPc | 43..263 | CDD:214473 | 43/245 (18%) | ||
CG33460 | NP_001033949.1 | Tryp_SPc | 44..252 | CDD:304450 | 45/248 (18%) |
Tryp_SPc | 44..249 | CDD:214473 | 43/245 (18%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | P | PTHR24260 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |