DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13527 and CG6592

DIOPT Version :9

Sequence 1:NP_001286744.1 Gene:CG13527 / 37615 FlyBaseID:FBgn0034776 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_648016.1 Gene:CG6592 / 38687 FlyBaseID:FBgn0035669 Length:438 Species:Drosophila melanogaster


Alignment Length:275 Identity:79/275 - (28%)
Similarity:120/275 - (43%) Gaps:64/275 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 GAHRMKRLSSPKFHGD-ETLELAKYVVSIRSRTPNKYFGDNHYCGGGLLSNQWVITAAHCVMGQS 83
            ||..|.|:    |.|| .......|.|.:..:.|...:    :|||.|:|::.||||||||    
  Fly   116 GAMAMDRI----FGGDVGNPHCFPYQVGMLLQRPKGLY----WCGGSLISDKHVITAAHCV---- 168

  Fly    84 KIMYKARWLLVVAGSPHRLRYTPGKSVCSPVSSLYVP-KNFTMHNTFN-------MALMKLQEKM 140
               ..|:..||..|: :.::....|...    .|.|| :||.::.|:|       :|:::|...:
  Fly   169 ---DMAKRALVFLGA-NEIKNAKEKGQV----RLMVPSENFQIYPTWNPKRLKDDIAIVRLPHAV 225

  Fly   141 PSNDPRIGFLHLPKEAPKIGIRH-----------TVLGWGRMYFGGPLAVH--IYQVDVVLMDNA 192
            ..|: ||..:.|||       ||           ...|||| |..|..|:.  :..|.:.::|..
  Fly   226 SFNE-RIHPIQLPK-------RHYEYRSFKNKLAIASGWGR-YATGVHAISNVLRYVQLQIIDGR 281

  Fly   193 VCKTYF--RHYGDGMMCAGNNNWTIDAEPCSGDIGSPLL------SGKVVVGIVAYPIGCGC-TN 248
            .||:.|  .:.|..:..:|.|    ....|:||.|.||:      ..:|:|||.::....|| ..
  Fly   282 TCKSNFPLSYRGTNICTSGRN----ARSTCNGDSGGPLVLQRRHSKKRVLVGITSFGSIYGCDRG 342

  Fly   249 IPSVYTDVFSGLRWI 263
            .|:.:|.|.|.|.||
  Fly   343 YPAAFTKVASYLDWI 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13527NP_001286744.1 Tryp_SPc 43..266 CDD:238113 72/251 (29%)
Tryp_SPc 43..263 CDD:214473 70/249 (28%)
CG6592NP_648016.1 Tryp_SPc 122..357 CDD:214473 74/267 (28%)
Tryp_SPc 123..359 CDD:238113 75/268 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.