DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13527 and yip7

DIOPT Version :9

Sequence 1:NP_001286744.1 Gene:CG13527 / 37615 FlyBaseID:FBgn0034776 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_523944.1 Gene:yip7 / 38680 FlyBaseID:FBgn0040060 Length:270 Species:Drosophila melanogaster


Alignment Length:291 Identity:67/291 - (23%)
Similarity:112/291 - (38%) Gaps:58/291 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 ILITVMVILSGA-----------HRMKRLSSPKFHG------DETLELAKYVVSIRSRTPNKYFG 57
            :.:.:::.|:.|           |...|:|:|...|      |.......|.|.:...:.    .
  Fly     3 VFVVLVLALASASAGLLPNIAPVHPRDRVSTPSITGRITNGKDAVAGQFPYQVGLSFSSS----A 63

  Fly    58 DNHYCGGGLLSNQWVITAAHCVMGQSK--IMYKARWLLVVAGSPHRLRYTPGKSVCSPVSSLYVP 120
            .:.:|||.::.|:||:|||||..|.:.  |.|.|    .|..||   .:|      ..|||    
  Fly    64 GSWWCGGSIIGNEWVLTAAHCTDGAASVTIYYGA----TVRTSP---EFT------QVVSS---- 111

  Fly   121 KNFTMHNTFNMALMK-----LQEKMPSNDPRIGFLHLPKEAPKI----GIRHTVLGWGRMYFGGP 176
            ..|..|.::....::     :|....|....:..:.||..:...    |......||| :.....
  Fly   112 SKFRQHESYLALTIRNDISLIQTSSVSFSATVNKISLPAVSNSYSTYEGKTAVASGWG-LTSDQA 175

  Fly   177 LAV--HIYQVDVVLMDNAVCKTYFRH--YGDGMMCAGNNNWTIDAEPCSGDIGSPLLSGKVVVGI 237
            .||  .:..||:.::.|:.|:..|..  ....::|....|   .|..|.||.|.||....|::|.
  Fly   176 TAVSRDLQYVDLTIISNSKCQETFGSLIVTSRVLCVDTTN---KASTCQGDSGGPLALDGVLIGA 237

  Fly   238 VAYPIGCGC-TNIPSVYTDVFSGLRWIRHTA 267
            .::....|| :..|:.:|.:.....||:.|:
  Fly   238 TSFGSADGCESGAPAAFTRITYYRDWIKETS 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13527NP_001286744.1 Tryp_SPc 43..266 CDD:238113 58/238 (24%)
Tryp_SPc 43..263 CDD:214473 56/235 (24%)
yip7NP_523944.1 Tryp_SPc 39..264 CDD:214473 57/249 (23%)
Tryp_SPc 40..267 CDD:238113 59/251 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.