DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13527 and CG10477

DIOPT Version :9

Sequence 1:NP_001286744.1 Gene:CG13527 / 37615 FlyBaseID:FBgn0034776 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_001303385.1 Gene:CG10477 / 38679 FlyBaseID:FBgn0035661 Length:272 Species:Drosophila melanogaster


Alignment Length:293 Identity:70/293 - (23%)
Similarity:108/293 - (36%) Gaps:71/293 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 ITVMVILSGAHRMKRLSSPKFHGDETLELAKYVVSIRSRTPN-----------------KYFGDN 59
            :.|:.|.:.:..:.|..:|....|.:.     |.||..|..|                 |....:
  Fly     6 VLVLAIATVSADILRQDTPVHPRDSSA-----VPSIDGRITNGNKAAANQFPYQVGLSFKSSAGS 65

  Fly    60 HYCGGGLLSNQWVITAAHCVMGQSKIMYKARWLLVVAGSPHRLRYTPGKSVCSPVSSLYVPKNFT 124
            .:|||.:::|.||:|||||..|.|.:       .:..||..|......|.|.|        ..|.
  Fly    66 WWCGGSIIANTWVLTAAHCTKGASSV-------TIYYGSTVRTSAKLKKKVSS--------SKFV 115

  Fly   125 MHNTFNMALMKLQEKMPSNDPRIGFLHLPKEAPKIGIRHTVL------------------GWGRM 171
            .|..:|.|.::       ||  |..:..|.....:.|....|                  ||||.
  Fly   116 QHAGYNAATLR-------ND--ISLIKTPSVTFTVSINKIALPAIASSYSTYAGQTAVASGWGRT 171

  Fly   172 YFGG-PLAVHIYQVDVVLMDNAVCKTYFRH--YGDGMMCAGNNNWTIDAEPCSGDIGSPLLSGKV 233
            .... .:|.::......::.||||:..|..  ...|::|..:.|   ....|.||.|.||.....
  Fly   172 SDSSIAVATNLQYAQFQVITNAVCQKTFGSSVVTSGVICVESIN---KKSTCQGDSGGPLALNNR 233

  Fly   234 VVGIVAYPIGCGC-TNIPSVYTDVFSGLRWIRH 265
            ::|:.::....|| .|.|:.:|.|.|.|.||::
  Fly   234 LIGVTSFVSSKGCEKNAPAGFTRVTSYLDWIKN 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13527NP_001286744.1 Tryp_SPc 43..266 CDD:238113 65/262 (25%)
Tryp_SPc 43..263 CDD:214473 63/258 (24%)
CG10477NP_001303385.1 Tryp_SPc 39..264 CDD:214473 60/251 (24%)
Tryp_SPc 40..267 CDD:238113 61/254 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.