DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13527 and CG32277

DIOPT Version :9

Sequence 1:NP_001286744.1 Gene:CG13527 / 37615 FlyBaseID:FBgn0034776 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_728835.1 Gene:CG32277 / 38393 FlyBaseID:FBgn0052277 Length:261 Species:Drosophila melanogaster


Alignment Length:287 Identity:74/287 - (25%)
Similarity:118/287 - (41%) Gaps:81/287 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 ILITVMVILSGAHRMK-----RLSSPKFHGDETLELAK---YVVSIRSRTPNKYFGDNHYCGGGL 66
            ||:..:.:|   |:::     .|...|..|.:| .|.|   ::|::|.       |....|||.:
  Fly     3 ILLIGLALL---HQLEGSSLFTLRQGKIFGGKT-TLVKDHSFLVNLRR-------GGKFRCGGVI 56

  Fly    67 LSNQWVITAAHCVMGQSKIMYKARWLLVVAGS--------PHRLR----------YTPGKSVCSP 113
            :|...|:|||||:.|:.:   :.|.|.|.|..        |..:|          |...:.:.|.
  Fly    57 ISPNCVLTAAHCLEGRYQ---QVRDLTVHAQQQCLGDDMPPEHVRSAWYVGLSPNYCAQRGLDSD 118

  Fly   114 VSSLYVPKNFTMHNTFNMALMKLQEKMPSNDPRIGFLHLPKEAPKIGIRHTVLGWGRMYFGGPLA 178
            ::.:.:.:.|.:..  |.:|:|:.    .||       ||..:     ..||||||.:...|   
  Fly   119 LAVIRLSRPFDIAG--NASLVKID----YND-------LPPHS-----NLTVLGWGAINEQG--- 162

  Fly   179 VH-----IYQVDVVLMDNAVCKTYFRHYGDG-------MMCAGNNNWTIDAEPCSGDIGSPLLSG 231
             |     :.:.:|.|:.:..|   .:..|.|       |.||...|   ..:.|.||.|.|.:..
  Fly   163 -HNWNQCLQEANVKLISHREC---IKSVGSGWQKVTNNMFCALGKN---ARDACQGDSGGPAIYA 220

  Fly   232 KVVVGIVAYPIGCGCTNIPSVYTDVFS 258
            ...||||::..||| :..|.|||.:.|
  Fly   221 GRSVGIVSWGYGCG-SGYPGVYTRLSS 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13527NP_001286744.1 Tryp_SPc 43..266 CDD:238113 64/246 (26%)
Tryp_SPc 43..263 CDD:214473 64/246 (26%)
CG32277NP_728835.1 Tryp_SPc 26..246 CDD:214473 68/259 (26%)
Tryp_SPc 27..246 CDD:238113 67/258 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456138
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.