DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13527 and CG3700

DIOPT Version :9

Sequence 1:NP_001286744.1 Gene:CG13527 / 37615 FlyBaseID:FBgn0034776 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster


Alignment Length:259 Identity:71/259 - (27%)
Similarity:108/259 - (41%) Gaps:52/259 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 YVVSIRSRTPNKYFGD-NHYCGGGLLSNQWVITAAHCVMGQSKIMYKARWLLVVAGSPH------ 100
            ::..|.:..|||...| |..|||.::..::|:|||||:.....   ||..|.....||.      
  Fly   115 FMALIGTHRPNKSKSDINWDCGGSVVHPKFVLTAAHCLETDES---KAERLDPNFDSPKFVVRLG 176

  Fly   101 RLRYTPGKSVCSPVSSLYVPK----NFTMHNTF-----------NMALMKLQEKMPSNDPRIGFL 150
            .|.|.      |......|..    |:.:|..:           ::||::|..|...|| .:..:
  Fly   177 ELDYN------STTDDALVQDFRVVNYVVHPGYDTEDEEQGFKNDIALVELDRKAEFND-HVAAV 234

  Fly   151 HLPKEAPKIGIRHTVLGWGRMYFGGPLAVHIYQVDVVLMDNAVCKTYFRHYGD--GMMCAGNNNW 213
            .||.::.....:.|..||| ....|..:.|:.:|::....:.||:...|...|  ...|||  :.
  Fly   235 CLPPDSGNDVQQVTAAGWG-FTADGVKSSHLLKVNLQRFSDEVCQKRLRFSIDTRTQFCAG--SM 296

  Fly   214 TIDAEPCSGDIGSPLLSG-------KVVVGIVAYPIGCGCTNIPSVYTDVFSGLRWIRHTAYDW 270
            :..|:.|:||.|.|:...       |.|:|||:|.:.||...:|||||.|        |...||
  Fly   297 SSQADTCNGDSGGPIFVQHPLYPCLKQVIGIVSYGLVCGSQGLPSVYTKV--------HLYTDW 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13527NP_001286744.1 Tryp_SPc 43..266 CDD:238113 68/253 (27%)
Tryp_SPc 43..263 CDD:214473 68/250 (27%)
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 71/259 (27%)
Tryp_SPc 102..353 CDD:214473 71/259 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456054
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.