DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13527 and CG12133

DIOPT Version :9

Sequence 1:NP_001286744.1 Gene:CG13527 / 37615 FlyBaseID:FBgn0034776 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_610540.2 Gene:CG12133 / 36036 FlyBaseID:FBgn0033469 Length:340 Species:Drosophila melanogaster


Alignment Length:265 Identity:62/265 - (23%)
Similarity:100/265 - (37%) Gaps:88/265 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 CGGGLLSNQWVITAAHCVMGQSKIMYKARWLLVVAGSPHRLRYT---PGKSVCSPVS-----SLY 118
            |.|.|:::::|:|||||:  .....|.||..|....:.:...||   .|..:.:|..     .|.
  Fly    94 CAGSLIASRYVLTAAHCL--NVNDFYVARVRLGEHDTENDPDYTWLPNGAKIWAPAHVDIDVDLR 156

  Fly   119 VP------KNFTMHNTFNMALMKLQEKM------------PSND-PRIGFLHLPKEAPKIGIRHT 164
            ||      :|...:|  ::||::|:.::            |..: ....|.:.|.:         
  Fly   157 VPHEQYYTRNGRHYN--DIALLRLKSRVKYTLQIRPICIWPGIELSTSSFKNFPFQ--------- 210

  Fly   165 VLGWGRMYFGGPLAVHIYQVDVVLMDNAVCKTYFRHYGDGMM---CAGNNNWTI----DAEPCS- 221
            :.|||..        .:.|...||....:         .||.   |. |...|:    |.:.|: 
  Fly   211 IAGWGDS--------GLQQKSTVLRQGTI---------SGMSPDECL-NRYPTLLVDKDIQICAM 257

  Fly   222 ---------GDIGSPLLS--GK------VVVGIVAYPIGCGCTNI---PSVYTDVFSGLRWIRHT 266
                     ||.||||::  |:      .:.||.:|  |.|.::.   |:|||...|...||:..
  Fly   258 GWDGTDTGLGDSGSPLMASVGRGADQFYYLAGITSY--GGGPSSYGYGPAVYTKTSSYYEWIKKK 320

  Fly   267 AYDWA 271
            ..|.|
  Fly   321 INDIA 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13527NP_001286744.1 Tryp_SPc 43..266 CDD:238113 60/258 (23%)
Tryp_SPc 43..263 CDD:214473 58/255 (23%)
CG12133NP_610540.2 Tryp_SPc 62..320 CDD:238113 60/258 (23%)
Tryp_SPc 62..317 CDD:214473 58/255 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.