DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13527 and CG30371

DIOPT Version :9

Sequence 1:NP_001286744.1 Gene:CG13527 / 37615 FlyBaseID:FBgn0034776 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_610370.1 Gene:CG30371 / 35806 FlyBaseID:FBgn0050371 Length:399 Species:Drosophila melanogaster


Alignment Length:233 Identity:54/233 - (23%)
Similarity:105/233 - (45%) Gaps:51/233 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 YCGGGLLSNQWVITAAHCVMGQSKIMYKARWLLVVAGSPHRLRYTPGKSVCSPVSSLYVPKNFTM 125
            :|||.::::::::|||||:...|    :|..::.:.|:         ..:.:|.||.|       
  Fly   177 FCGGTIVAHRYILTAAHCIYQVS----RATNIVAIVGT---------NDLGNPSSSRY------- 221

  Fly   126 HNTFNMALMKLQEKMPSNDP-------------------RIGFLHLPKEAPKIGIRH---TVLGW 168
            :..:|:..|...|:..| ||                   .:|.:.||.........:   .|:|:
  Fly   222 YQQYNIQQMIPHEQYVS-DPDVNNDIAVLITASNIQWSRGVGPICLPPVGTSTPFTYDLVDVIGY 285

  Fly   169 GRMYFGGPLAVHIYQVDVVLMDNAVCKTYFRHYG---DGMMCAGNNNWTIDAEPCSGDIGSPLL- 229
            |.::|.||.:..:.::::.::.|..|:|.:.:..   .|.||..:.:.| ..:.|..|.|.|:: 
  Fly   286 GTVFFAGPTSTSLQKINLNVVTNQDCQTEYNNVATIYTGQMCTYDYSGT-GRDSCQFDSGGPVIL 349

  Fly   230 --SGKVVVGIVAYPIGCGCTNIP-SVYTDVFSGLRWIR 264
              |.:.:|||::|...|..:..| .|.|.:.|.:.|||
  Fly   350 RKSRQFLVGIISYGKSCAESQYPMGVNTRITSYISWIR 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13527NP_001286744.1 Tryp_SPc 43..266 CDD:238113 54/233 (23%)
Tryp_SPc 43..263 CDD:214473 51/230 (22%)
CG30371NP_610370.1 CUB 24..>67 CDD:294042
Tryp_SPc 149..386 CDD:214473 51/230 (22%)
Tryp_SPc 150..389 CDD:238113 54/233 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455997
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.