DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13527 and CG14760

DIOPT Version :9

Sequence 1:NP_001286744.1 Gene:CG13527 / 37615 FlyBaseID:FBgn0034776 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_610366.1 Gene:CG14760 / 35802 FlyBaseID:FBgn0033277 Length:529 Species:Drosophila melanogaster


Alignment Length:280 Identity:62/280 - (22%)
Similarity:112/280 - (40%) Gaps:66/280 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 GAHRMKRLSSPKFHGDETLELAKY--VVSIRSRTPNKYFGDNHYCGGGLLSNQWVITAAHCVMGQ 82
            |..|:.|::||.   :|...|.::  :..:.::...|.|     ||..::.::::::||||.:|.
  Fly   268 GWSRIPRIASPT---NEEAVLHEFPPMAGVLTKKHGKVF-----CGAAIIHHRYLLSAAHCFLGP 324

  Fly    83 SKIMYKARWLLVVAGSPHRLRYTPGKSVCSPVSSLYVPKNF-----TMHNTFNMALMKLQEKMPS 142
            .            ..|..:||...|:...:.....:..:.:     .:|..|:.|     ...|.
  Fly   325 E------------TNSAAKLRVVVGEHDLASSFETFATQRYDLDALILHEDFSQA-----SGQPK 372

  Fly   143 ND-------------PRIGFLHLP-------KEAPKIGIRHTVLGWGRMYFGGPLAVHIYQVDVV 187
            ||             ..:|...||       ::.|..|.:....|||...:|||....:.:..:.
  Fly   373 NDIAMLKTRMAIVWSQHVGPACLPLQPGEDGQKLPLAGHQVVAAGWGTTSYGGPQTHRLLKATLD 437

  Fly   188 LMDNAVCKTYFRHYGDGM----MCAGNNNWTIDAEPCSGDIGSPL---LSGKVV-VGIVAYPIGC 244
            ::|...|:......| |:    .|    .:|...:.|..|.|..|   ::|::: ||||::...|
  Fly   438 VIDGRRCRQALSSAG-GLPPHTFC----TYTPGRDTCQYDSGGALYERINGRLMAVGIVSFGQAC 497

  Fly   245 GCTNIPSVYTDVFSGLRWIR 264
            .... |||.|.|.|.::|||
  Fly   498 AAQQ-PSVNTRVASFIKWIR 516

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13527NP_001286744.1 Tryp_SPc 43..266 CDD:238113 55/257 (21%)
Tryp_SPc 43..263 CDD:214473 52/254 (20%)
CG14760NP_610366.1 CUB 37..126 CDD:294042
Tryp_SPc 281..516 CDD:238113 55/262 (21%)
Tryp_SPc 281..515 CDD:214473 54/261 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456001
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.