DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13527 and CG17572

DIOPT Version :9

Sequence 1:NP_001286744.1 Gene:CG13527 / 37615 FlyBaseID:FBgn0034776 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_609941.2 Gene:CG17572 / 35182 FlyBaseID:FBgn0032753 Length:385 Species:Drosophila melanogaster


Alignment Length:246 Identity:61/246 - (24%)
Similarity:94/246 - (38%) Gaps:71/246 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 CGGGLLSNQWVITAAHCVMGQSKIMYKARWLLVVAGSPHRL------RYTPGK-------SVCSP 113
            |.|.:::.:.::|||||.:.::              ..|||      .|....       ..|:|
  Fly   160 CAGAVIARRVILTAAHCALAKA--------------DGHRLSSVRVGEYDTSSDPDCANTGFCAP 210

  Fly   114 VSSLYVPKNFTMHNTF-------NMALMKLQEKMPSN-----DPRIGFLHLPKEAPK--IGIRHT 164
            .|..:...:..:|..:       ::||:.|  |.|.|     .|    :.|.|....  :|.|.|
  Fly   211 RSVNHAISHVIVHPDYKQGQYHHDIALLVL--KTPLNYSVATQP----ICLQKTRANLVVGKRAT 269

  Fly   165 VLGWGRMYFGGPLAVHIYQVDVVLMDNAVCKTYFRHYG-----------DGM-MCAGNNNWTIDA 217
            :.|||:|.........:..:||.|....:|   .|:||           :|. ||||...    .
  Fly   270 IAGWGKMSTSSVRQPEMSHLDVPLTSWDLC---LRNYGSTGALESPNSIEGQWMCAGGEG----K 327

  Fly   218 EPCSGDIGSPLLSGK----VVVGIVAY-PIGCGCTNIPSVYTDVFSGLRWI 263
            :.|.|..|:||...:    ..:||::: ...||...||||||.|.....||
  Fly   328 DVCQGFGGAPLFIQENGIFSQIGIMSFGSDNCGGLRIPSVYTSVAHFSEWI 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13527NP_001286744.1 Tryp_SPc 43..266 CDD:238113 61/246 (25%)
Tryp_SPc 43..263 CDD:214473 59/244 (24%)
CG17572NP_609941.2 Tryp_SPc 138..381 CDD:238113 61/246 (25%)
Tryp_SPc 138..378 CDD:214473 59/244 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.