DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13527 and Jon25Bi

DIOPT Version :9

Sequence 1:NP_001286744.1 Gene:CG13527 / 37615 FlyBaseID:FBgn0034776 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_001033873.1 Gene:Jon25Bi / 33708 FlyBaseID:FBgn0020906 Length:266 Species:Drosophila melanogaster


Alignment Length:256 Identity:72/256 - (28%)
Similarity:112/256 - (43%) Gaps:60/256 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 PKFHGDETLELAKYVVSIRSRTPNKYFGDN--HYCGGGLLSNQWVITAAHCVMGQSK--IMYKAR 90
            |.:.|.     |.|.|.:.       |..|  .:|||.::::.||:|||||..|.|:  |.|.|.
  Fly    42 PAYEGK-----APYTVGLG-------FSGNGGWWCGGSIIAHDWVLTAAHCTNGASQVTIYYGAT 94

  Fly    91 WLLVVAGSPHRLRYTPGKSVCSPVSSLYVPK-NFTMHNTFNMALMKLQEKMPSNDPRIGFLHLPK 154
            |     .:..:..:|.|       |..::.. |:...|..::||::        .|.:.|.|:..
  Fly    95 W-----RTNAQFTHTVG-------SGDFIQNHNWPNQNGNDIALIR--------TPHVDFWHMVN 139

  Fly   155 --EAPKIGIRHTV--------LGWGRMYFGGPLAVHIYQVDVVLMDNAVCKTYFRHYG---DGMM 206
              |.|....|:.:        .||| :...|.....:..||:.::.|:.|.   |.||   ||::
  Fly   140 KVELPSFNDRYNMYDNYWAVACGWG-LTTAGSQPDWMECVDLQIISNSECS---RTYGTQPDGIL 200

  Fly   207 CAGNNNWTIDAEPCSGDIGSPLL--SGKVVVGIVAYPIGCGCT-NIPSVYTDVFSGLRWIR 264
            |...:.   ....||||.|.||:  .|..:||:.::..|.||| .:||.:|.|.:.|.|||
  Fly   201 CVSTSG---GKSTCSGDSGGPLVLHDGGRLVGVTSWVSGNGCTAGLPSGFTRVTNQLDWIR 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13527NP_001286744.1 Tryp_SPc 43..266 CDD:238113 69/243 (28%)
Tryp_SPc 43..263 CDD:214473 66/240 (28%)
Jon25BiNP_001033873.1 Tryp_SPc 36..257 CDD:214473 69/253 (27%)
Tryp_SPc 37..260 CDD:238113 72/256 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.