DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13527 and Jon25Bii

DIOPT Version :9

Sequence 1:NP_001286744.1 Gene:CG13527 / 37615 FlyBaseID:FBgn0034776 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_001285608.1 Gene:Jon25Bii / 33707 FlyBaseID:FBgn0031654 Length:276 Species:Drosophila melanogaster


Alignment Length:270 Identity:70/270 - (25%)
Similarity:103/270 - (38%) Gaps:76/270 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 SIRSRTPNKY--------------FGDNH---YCGGGLLSNQWVITAAHCVMGQSK--IMYKARW 91
            ||..|..|.|              |..:.   :|||.::.:.||||||||..|...  |.|.|.|
  Fly    38 SIEGRITNGYPAYEGKVPYIVGLGFSSDSGGWWCGGSIIGHTWVITAAHCTHGAHSVTIYYGALW 102

  Fly    92 LLVVAGSPHRLRYTPGKSVCSPVSSLYVPKNFTMHNTFN-------MALMKLQEKMPSNDPRIGF 149
            .|..     :..:|.|..            :|..|:.:|       ::|:        |.|.:.|
  Fly   103 RLQA-----QYTHTVGSG------------HFRQHSDYNTNNLNNDISLI--------NTPHVDF 142

  Fly   150 LHL--PKEAPKIGIRH--------TVLGWGRMYFGGPLAVHIYQVDVVLMDNAVCKTYFRHYG-- 202
            .||  ..|.|....||        ...||||......::.::..||..::....|.:.   ||  
  Fly   143 WHLINKVELPDGNERHDSFAGWWALASGWGRPCDSCGVSDYLNCVDSQIITRDECSSV---YGTD 204

  Fly   203 ---DGMMCAGNNNWTIDAEPCSGDIGSPLL--SGKVVVGIVAYPIGCGCTN-IPSVYTDVFSGLR 261
               |.::|.....   ....|:||.|.||:  ....:||:.::....|||: :|..:|.|.|.|.
  Fly   205 VITDNVICTSTPG---GKSTCAGDSGGPLVLHDRSKLVGVTSFVAASGCTSGLPDGFTRVTSYLD 266

  Fly   262 WIR-HTAYDW 270
            ||| ||...:
  Fly   267 WIRDHTGISY 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13527NP_001286744.1 Tryp_SPc 43..266 CDD:238113 68/264 (26%)
Tryp_SPc 43..263 CDD:214473 65/260 (25%)
Jon25BiiNP_001285608.1 Tryp_SPc 42..268 CDD:214473 63/256 (25%)
Tryp_SPc 43..271 CDD:238113 65/258 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.