DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13527 and Hayan

DIOPT Version :9

Sequence 1:NP_001286744.1 Gene:CG13527 / 37615 FlyBaseID:FBgn0034776 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_001097020.1 Gene:Hayan / 32831 FlyBaseID:FBgn0030925 Length:637 Species:Drosophila melanogaster


Alignment Length:240 Identity:63/240 - (26%)
Similarity:96/240 - (40%) Gaps:35/240 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 FGDNHY-CGGGLLSNQWVITAAHCVMGQSKIMYKARWLLVVAGSPHRLRYTPGKSVCSPVSSLYV 119
            ||...: |||.|:::::|:||||||..........|...:...:|.     ||....:.:.....
  Fly   407 FGSAAFRCGGSLIASRFVLTAAHCVNSDDSTPSFVRLGALNIENPE-----PGYQDINVIDVQIH 466

  Fly   120 PKNFTMHNTFNMALMKLQEKMPSNDP-RIGFLHLPKEAPKIGIRHTVLGWGRMYFGGPLAVHIY- 182
            |........:::|:::|.|....:|. |...|:..:..|....::.|.|||.|.........|. 
  Fly   467 PDYSGSSKYYDIAILQLAEDAKESDVIRPACLYTDRSDPPANYKYFVAGWGVMNVTNRAVSKILL 531

  Fly   183 --QVDVVLMDNAVCKTYF-----------RHYGDGMMCAGNNNWTIDAEPCSGDIGSPLL----- 229
              .:|:|..|.  |...|           |......:||.:.|...||  |.||.|.||:     
  Fly   532 RAALDLVPADE--CNASFAEQPSANRTLRRGVIASQLCAADKNQRKDA--CQGDSGGPLILEIDD 592

  Fly   230 -SGKV-VVGIVAYPIGCGCTNIPSVYTDVFSGLRWIRHTAYDWAS 272
             .|.. :||:::...|| .|..|.:||.|.|.|.:|....  |.|
  Fly   593 VDGTYSIVGVISSGFGC-ATKTPGLYTRVSSFLDYIEGIV--WPS 634

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13527NP_001286744.1 Tryp_SPc 43..266 CDD:238113 61/232 (26%)
Tryp_SPc 43..263 CDD:214473 60/229 (26%)
HayanNP_001097020.1 CLIP 32..80 CDD:197829
Tryp_SPc 384..627 CDD:214473 60/229 (26%)
Tryp_SPc 385..630 CDD:238113 61/232 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.