DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13527 and CG31269

DIOPT Version :9

Sequence 1:NP_001286744.1 Gene:CG13527 / 37615 FlyBaseID:FBgn0034776 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster


Alignment Length:278 Identity:72/278 - (25%)
Similarity:128/278 - (46%) Gaps:44/278 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 AILITVMVILSG-----AHRMKRLSSP-KFHGDETL--------ELAKYVVSIRSRTPNKYFGDN 59
            |:::.:::.|||     |.|:|..|:. :|:.|:.:        ..|.|.:|::.      ....
  Fly     3 AVVLLILLGLSGLVSITAIRIKGNSTDGRFYKDQRIIGGQAAEDGFAPYQISLQG------ISGA 61

  Fly    60 HYCGGGLLSNQWVITAAHCVMGQSKIMYKARWLLVVAGSPHRLRYT-PGKSVCSPVSSLYVPKNF 123
            |.|||.:::..:|:||||||....     ..||:||.|:.   :|. ||....  :.::::..|:
  Fly    62 HSCGGAIINETFVLTAAHCVENAF-----IPWLVVVTGTN---KYNQPGGRYF--LKAIHIHCNY 116

  Fly   124 ---TMHNTFNMALMKLQEKMPSNDPRIGFLHLPKEAPKIGIRHTVLGWGRMYFGGPLAVHIYQVD 185
               .|||  ::||::|.|.: :.|.|...:.||....:.|....:.|||.....|...:.:..:.
  Fly   117 DNPEMHN--DIALLELVEPI-AWDERTQPIPLPLVPMQPGDEVILTGWGSTVLWGTSPIDLQVLY 178

  Fly   186 VVLMDNAVCKTYFRHYGD---GMMCAGNNNWTIDAEPCSGDIGSPLLSGKVVVGIVAYPIGCGCT 247
            :..:.:..||....:..|   |.:|..:.   :....|.||.|.||:|...:||:|.:...| .|
  Fly   179 LQYVPHRECKALLSNDEDCDVGHICTFSR---LGEGACHGDSGGPLVSNGYLVGLVNWGWPC-AT 239

  Fly   248 NIPSVYTDVFSGLRWIRH 265
            .:|.|:..|:....|||:
  Fly   240 GVPDVHASVYFYRDWIRN 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13527NP_001286744.1 Tryp_SPc 43..266 CDD:238113 61/230 (27%)
Tryp_SPc 43..263 CDD:214473 58/226 (26%)
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 59/240 (25%)
Tryp_SPc 38..258 CDD:238113 62/243 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.