DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13527 and sphinx1

DIOPT Version :9

Sequence 1:NP_001286744.1 Gene:CG13527 / 37615 FlyBaseID:FBgn0034776 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_729255.2 Gene:sphinx1 / 318005 FlyBaseID:FBgn0052383 Length:253 Species:Drosophila melanogaster


Alignment Length:281 Identity:64/281 - (22%)
Similarity:115/281 - (40%) Gaps:57/281 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 ILITVMVI-LSGAHRMKRLSSPKFHGD---ETLELAKYVVSI---RSRTPNKYFGDNHYCGGGLL 67
            :::|::|: |:.:...|...||:..|.   :|..:. |:|.|   :|:|.:..:|     .|.::
  Fly     3 LVVTLLVLSLTVSVGEKNKLSPRIAGGYRAKTFTII-YLVGIVYFKSQTSSLNYG-----AGTII 61

  Fly    68 SNQWVITAAHCVMGQSKIMYKARWLLVVAGSPHRLRYTPGKSVCSPVSSLYVPKNFTMH--NTFN 130
            ||||::|.        |.:.|..::.|...|....|   |..:.    .:| .:||..|  |...
  Fly    62 SNQWILTV--------KTVLKYSYIEVHLASRRSYR---GFDII----RIY-KENFRFHYDNDHV 110

  Fly   131 MALMKL----------QEKMPSNDPRIGFLHLPKEAPKIGIRHTVLGWGRMYFGGPLAVHIYQVD 185
            :||:|.          :.::|:.|.|.        ...:|....|.|:|.......|...:..::
  Fly   111 IALVKCPYQKFDRRMDRVRVPAYDTRF--------ERYVGNMTMVCGYGTEKRHAKLPEWMRCIE 167

  Fly   186 VVLMDNAVCKTYFRHYGDGMMCAGNNNWTIDAEPCSGDIGSPLLS---GKVVVGIV-AYPIGCGC 246
            |.:|:|..|..|:.......||.....:   ...|.||||..:::   ....:||: ..|..|. 
  Fly   168 VEVMNNTECAKYYTPLKWYEMCTSGEGF---KGVCEGDIGGAVVTMGPNPTFIGIIWLMPENCS- 228

  Fly   247 TNIPSVYTDVFSGLRWIRHTA 267
            ...|||:..|...::||:..:
  Fly   229 IGYPSVHIRVSDHIKWIKRVS 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13527NP_001286744.1 Tryp_SPc 43..266 CDD:238113 56/241 (23%)
Tryp_SPc 43..263 CDD:214473 54/238 (23%)
sphinx1NP_729255.2 Tryp_SPc 25..245 CDD:214473 56/253 (22%)
Tryp_SPc 26..248 CDD:304450 58/255 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.