DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13527 and CG32260

DIOPT Version :9

Sequence 1:NP_001286744.1 Gene:CG13527 / 37615 FlyBaseID:FBgn0034776 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_728942.1 Gene:CG32260 / 317943 FlyBaseID:FBgn0052260 Length:575 Species:Drosophila melanogaster


Alignment Length:245 Identity:70/245 - (28%)
Similarity:115/245 - (46%) Gaps:50/245 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 YFGDNH------YCGGGLLSNQWVITAAHCVMGQSKIMYKARWLLVVAGSPHRLRYTPGKSVCSP 113
            ||.:|:      .|||.|:.:::|||:|||:...         |.:|....|.|. .|.:|....
  Fly   347 YFEENNRNALKFLCGGSLIHSRYVITSAHCINPM---------LTLVRLGAHDLS-QPAESGAMD 401

  Fly   114 --VSSLYVPKNFTMHNTFN-MALMKLQ--EKMPSNDPRIGFLHLPKEAPK------IGIRHTVLG 167
              :....|.::|.:::..| :||::|.  ..:|.|   |..:.|| ||.|      :|:...|.|
  Fly   402 LRIRRTVVHEHFDLNSISNDIALIELNVVGALPGN---ISPICLP-EAAKFMQQDFVGMNPFVAG 462

  Fly   168 WGRMYFGGPLAVHIYQVDVVLMDNAVCKTYFR------HYGDGMMCAGNNNWTIDAEPCSGDIGS 226
            ||.:...|..:..:....|.::....|:..::      .:.|.::|||::  ::||  |.||.|.
  Fly   463 WGAVKHQGVTSQVLRDAQVPIVSRHSCEQSYKSIFQFVQFSDKVLCAGSS--SVDA--CQGDSGG 523

  Fly   227 PL----LSGKV----VVGIVAYPIGCGCTNIPSVYTDVFSGLRWI-RHTA 267
            ||    |.|.|    ::|:|::...|...|.|.|||.|.|.:.|| :|.|
  Fly   524 PLMMPQLEGNVYRFYLLGLVSFGYECARPNFPGVYTRVASYVPWIKKHIA 573

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13527NP_001286744.1 Tryp_SPc 43..266 CDD:238113 68/242 (28%)
Tryp_SPc 43..263 CDD:214473 66/238 (28%)
CG32260NP_728942.1 CLIP 194..244 CDD:288855
Tryp_SPc 327..568 CDD:214473 66/238 (28%)
Tryp_SPc 328..571 CDD:238113 68/241 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456140
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.