DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13527 and CG11664

DIOPT Version :9

Sequence 1:NP_001286744.1 Gene:CG13527 / 37615 FlyBaseID:FBgn0034776 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_569865.1 Gene:CG11664 / 31033 FlyBaseID:FBgn0040341 Length:254 Species:Drosophila melanogaster


Alignment Length:238 Identity:57/238 - (23%)
Similarity:96/238 - (40%) Gaps:67/238 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 YVVSIRSRTPNKYFGDNHYCGGGLLSNQWVITAAHCVMGQSK---IMYKA--RWLL------VVA 96
            ||:.|        :|......|.|.|.::|:|.|||....:|   :..:|  ||:.      .||
  Fly    36 YVMQI--------YGPQFLAAGSLFSARYVLTVAHCFKKNTKPEELSVRAGYRWIAWEFRGKQVA 92

  Fly    97 GSPHRLRYTPGKSVCSPVSSLYVPKNFTMHNTFNMALMKLQEKMPSNDPRIGFLHL--------- 152
            |.....:::|                .|:.|  ::|:::::..: |:...|.::.|         
  Fly    93 GLLRHPKFSP----------------LTLRN--DIAVLRVKAAI-SHSHMINYIGLCSRPLTPLN 138

  Fly   153 ----PKEAPKIGIRHTVLGWGRMYFGGPLAVHIYQVDVVLMDNAVCKTYFRHYGDGMMCAGNNNW 213
                |:|         :.||..|:...||.....||:    ....|:.:|.....|::||   :.
  Fly   139 MFAPPQE---------LAGWNLMHIAQPLKSMSVQVE----PEKNCRQWFPQISGGVICA---SA 187

  Fly   214 TIDAEPCSGDIGSPLLSGKVVVGIVAYPIGCGCTNIPSVYTDV 256
            |:....|.||.|.||:||..|.|:......||....|:::|||
  Fly   188 TMGEGLCYGDSGDPLISGGEVCGLAIAFRKCGDKRYPALFTDV 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13527NP_001286744.1 Tryp_SPc 43..266 CDD:238113 57/238 (24%)
Tryp_SPc 43..263 CDD:214473 57/238 (24%)
CG11664NP_569865.1 Tryp_SPc 38..239 CDD:304450 55/236 (23%)
Tryp_SPc 38..237 CDD:214473 55/236 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.