DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13527 and CG33462

DIOPT Version :9

Sequence 1:NP_001286744.1 Gene:CG13527 / 37615 FlyBaseID:FBgn0034776 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster


Alignment Length:284 Identity:67/284 - (23%)
Similarity:99/284 - (34%) Gaps:80/284 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 SIRSRTPNKYFGDN-----------HYCGGGLLSNQWVITAAHCVMGQSKIMYKARWLLVVAGSP 99
            :|..|:.|.....|           .:|.|.|:::.:|:||||||...         ||:..   
  Fly    34 NISERSVNAKLAQNPWMAYLETPKGFHCSGTLINHLFVLTAAHCVPDD---------LLITV--- 86

  Fly   100 HRL-RY-TPGKSVC------SPVSSLYVPKNFTMHNTFNMALMKLQEKMPSNDPR--IGFLHLPK 154
             || .| |..|..|      .|.....|...| .|..:|           :||..  ||.|.|.:
  Fly    87 -RLGEYNTKTKVDCDNHLCQEPFQEYNVDMGF-RHRYYN-----------ANDQTNDIGMLRLGR 138

  Fly   155 EAPKIGIRHTVLGWGRMYFGGPLAVHIYQVDVVLMD---NAVCK-------------TYFRHYGD 203
            ....:.....:..:....|..|:....:....|..:   ||..|             |....||.
  Fly   139 RVEYLNHIRPICIFASNRFQEPIDQLTWFTTTVWRETAANATSKVLRTMNIDRQPKETCSEIYGW 203

  Fly   204 GM----MCAGNNNWTIDAEPCSGDIGSPLL-----SGK---VVVGIVAYPIGCGCTNIPSVYTDV 256
            .|    :||||   |: ::.||.|.|:|.:     :|.   |.:||.:...| .|.| ..:..|:
  Fly   204 NMTFEQICAGN---TL-SQLCSTDSGAPQIRKMWHNGSDRYVQLGIASRVKG-QCQN-SGILMDL 262

  Fly   257 FSGLRWIRHTAYDWASITKTNPTL 280
            .|...||:.....:...|..|.:|
  Fly   263 LSYADWIKRVVRQYGPSTDMNRSL 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13527NP_001286744.1 Tryp_SPc 43..266 CDD:238113 64/268 (24%)
Tryp_SPc 43..263 CDD:214473 62/265 (23%)
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 60/254 (24%)
Tryp_SPc 48..269 CDD:214473 58/251 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.