DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13527 and CG30323

DIOPT Version :9

Sequence 1:NP_001286744.1 Gene:CG13527 / 37615 FlyBaseID:FBgn0034776 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_725729.2 Gene:CG30323 / 246539 FlyBaseID:FBgn0050323 Length:306 Species:Drosophila melanogaster


Alignment Length:278 Identity:69/278 - (24%)
Similarity:109/278 - (39%) Gaps:52/278 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 VVSIRSRTPNKYFGDNHYCGGGLLSNQWVITAAHCVMGQSKIM----YKARWLLVVAGSPHRLRY 104
            |||||:|...:::||||:|.|.|||..||:|:..||..:.:..    ...:.|.||..:|.||:.
  Fly    36 VVSIRTRKHIRHWGDNHFCAGSLLSAWWVVTSGCCVSTRPESTPNQPSNRKNLRVVVFTPKRLKK 100

  Fly   105 TPGKSVCSPVSSLYVPK----NFTMHNTFNMALMKLQEKMPSNDPRIGFLHLPKEAPKIGIRHTV 165
            .      ||.:..:|.|    ...:.....:||:||...:...  |...:...||.....:.:: 
  Fly   101 P------SPKNIYHVQKIVLDESAISGCTELALLKLDRGVTGQ--RFAMMLPEKELNSTWLCNS- 156

  Fly   166 LGWGRMYF-------------------------GGPLAVHIYQVDVVLMDNAVCKTYFRHYGDGM 205
            |||||:|:                         .||.:..:.|:....:....||.      |..
  Fly   157 LGWGRIYYVSYVYISAMCPAFSMVYDNPVTWFQDGPYSSELIQIRAQKISEYECKP------DCS 215

  Fly   206 MCAGNNNWTIDAEPCSGDIGSPLLSGKVVVGIVAYPIGCGCTNIPSVYTDVFSGLRWIRHTAYDW 270
            .|....::|.....|..|:||||.....:.|:......|..... ..||:::...::|..|.   
  Fly   216 RCLCMTSYTGRGNMCQQDLGSPLFCDHFLYGVARRVHTCDDEGF-MFYTNIYQNRKFIEDTL--- 276

  Fly   271 ASITKTNPTLMFILLYVL 288
            :..|.....|.|.||.:|
  Fly   277 SGATWPKRVLCFRLLLLL 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13527NP_001286744.1 Tryp_SPc 43..266 CDD:238113 62/254 (24%)
Tryp_SPc 43..263 CDD:214473 61/251 (24%)
CG30323NP_725729.2 Tryp_SPc 45..275 CDD:304450 56/245 (23%)
Tryp_SPc 45..272 CDD:214473 55/242 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0008551
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.