DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13527 and CG30187

DIOPT Version :9

Sequence 1:NP_001286744.1 Gene:CG13527 / 37615 FlyBaseID:FBgn0034776 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_001246475.2 Gene:CG30187 / 246509 FlyBaseID:FBgn0050187 Length:500 Species:Drosophila melanogaster


Alignment Length:286 Identity:61/286 - (21%)
Similarity:105/286 - (36%) Gaps:83/286 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 ITVMVILSGAHRMKRLSSPKFHGDETLELAKYVVSIRSRTPNKYFGDNHY-CGGGLLSNQWVITA 75
            |.:.:.::|.|            :...:.:.::.::.:||        |: |||.|:..::|:||
  Fly    30 INIALKITGGH------------NAAFQNSVWMAAVHNRT--------HFICGGTLIHKRFVLTA 74

  Fly    76 AHCVMGQSKIMYKARWLLVVAGSPHRLRYTPGKSVCSPVSSLYVPKNFTMHNTFNMALMKLQEKM 140
            |||::.|..       ..|..|:.::......|.|.:.|          :|::|::        .
  Fly    75 AHCIVDQDV-------QSVSLGAYNKSDPADRKDVITAV----------VHSSFDV--------R 114

  Fly   141 PSNDPRIGFLHLPKEA-------------PKIGIRH-------TVLGWGRMYFGGPLAVHIYQVD 185
            .|.:..||.|.|..:.             .|....|       ...|||.:  .|.....|.|. 
  Fly   115 ASYENDIGLLKLSSDVIFNALIRPICIVLNKSMANHMRNMRTFKAFGWGTL--RGNKTSDILQT- 176

  Fly   186 VVL--MDNAVCKTYFRHY-GDGMMCAGNNNWTIDAEPCSGDIGSPLLSGKVVVGIVAYPIGCGCT 247
            ::|  :|...|......| .:..:|||    ....:.|.||.|.||.:...:.||....:..|..
  Fly   177 IILNHLDREECYMELSVYPSEKQICAG----VPSGDTCGGDSGGPLTNDVFIQGIGNREVQFGII 237

  Fly   248 NI-------PSVYTDVFSGLRWIRHT 266
            ::       ..||||:.|...||:.|
  Fly   238 SVGKTSCDGQGVYTDLMSFADWIKMT 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13527NP_001286744.1 Tryp_SPc 43..266 CDD:238113 57/253 (23%)
Tryp_SPc 43..263 CDD:214473 55/250 (22%)
CG30187NP_001246475.2 Tryp_SPc 35..260 CDD:214473 57/276 (21%)
Trypsin 316..>384 CDD:355628
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.