DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13527 and CG30098

DIOPT Version :9

Sequence 1:NP_001286744.1 Gene:CG13527 / 37615 FlyBaseID:FBgn0034776 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_725573.2 Gene:CG30098 / 246456 FlyBaseID:FBgn0050098 Length:264 Species:Drosophila melanogaster


Alignment Length:280 Identity:72/280 - (25%)
Similarity:122/280 - (43%) Gaps:50/280 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 ILITVMVILS-GAHRMKRLSSPKFHGDETLELAKYVVSI-----RSRTPNKYF--GDNHY-CGGG 65
            :|:|.:|||: |::...:|...|.       :|.:.:.:     ..|||...:  .||.: |||.
  Fly     6 VLLTFLVILTLGSYGYSQLLDSKC-------IALFRIRVIGGQNARRTPWMAYLIRDNRFACGGS 63

  Fly    66 LLSNQWVITAAHCVMGQSKIMYKARWLLVVAGSPHRLRYTPGKSVCSPVSSLYVPKNFTMHNTFN 130
            |::.::|:|||||    :||...   |.|..|.....|.|.|::....|.|:|..||:......:
  Fly    64 LIAYRFVLTAAHC----TKINDN---LFVRLGEYDSSRTTDGQTRSYRVVSIYRHKNYIDFRNHD 121

  Fly   131 MALMKLQEKMPSN---DPRIGFLHLPKEAPKIGIRH-TVLGWGRMYFGGPLAVHIYQVDVVLMDN 191
            :|::||..::..:   .|....|:...::....|:: |:.|||:|       .|.|::...|.:.
  Fly   122 IAVLKLDRQVVYDAYIRPICILLNSGLQSLANSIQNFTLTGWGQM-------AHYYKMPTTLQEM 179

  Fly   192 AVCKTYFRHYG--DGMMCAGNNNWTIDAEPCSGDIGSPLLSGKVV-VGIVAYPIGCGCTNIP--- 250
            ::.:....:.|  ...:|.    |......|.||.|.||  |.:| .|.....:..|.||..   
  Fly   180 SLRRVRNEYCGVPSLSICC----WNPVQYACFGDSGGPL--GSLVKYGHKTIYVQFGVTNSVTGN 238

  Fly   251 ----SVYTDVFSGLRWIRHT 266
                |.|.|:.|.:.|:..|
  Fly   239 CDGYSSYLDLMSYMPWLYQT 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13527NP_001286744.1 Tryp_SPc 43..266 CDD:238113 62/244 (25%)
Tryp_SPc 43..263 CDD:214473 61/241 (25%)
CG30098NP_725573.2 Tryp_SPc 36..254 CDD:214473 61/237 (26%)
Tryp_SPc 37..258 CDD:238113 62/240 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.