DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13527 and CG30091

DIOPT Version :9

Sequence 1:NP_001286744.1 Gene:CG13527 / 37615 FlyBaseID:FBgn0034776 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_725484.1 Gene:CG30091 / 246449 FlyBaseID:FBgn0050091 Length:526 Species:Drosophila melanogaster


Alignment Length:236 Identity:61/236 - (25%)
Similarity:102/236 - (43%) Gaps:38/236 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 DNHYCGGGLLSNQWVITAAHCVMGQSKIMYKARWLLVVAG-----------SPHRLRYTPGKSVC 111
            |...|||.:::|::|:|||||:....:.:.|...|.|..|           .||.: |.      
  Fly    58 DEFICGGSVITNKFVLTAAHCMCTDEECIVKYTQLTVTLGVYHLLATGEHNHPHEI-YN------ 115

  Fly   112 SPVSSLYVPKNFTMHNTFN-MALMKLQEKM---PSNDPRIGFLHLPKEAPKIGI--RHTVLGWGR 170
              |..:|:..:|.:.|..| :||::||:.:   |...|....|: .:..|:..:  ..|.:||| 
  Fly   116 --VERVYIHDSFAIQNYRNDIALLRLQKSIVYKPQIKPLCILLN-DQLKPQTDLIQEFTAIGWG- 176

  Fly   171 MYFGGPLAVHIYQVDVVLMDNAVCKTYFRHYGD-GMMCAGNNNWTIDAEPCSGDIGSPLLSGKVV 234
            :...|.::.::..|.:..:|..:|:..|.:..| .|.|||.   .:..:.|..|.|.||....:.
  Fly   177 VTGNGKMSNNLQMVKIYRIDRKMCEAAFWYTFDYPMFCAGT---AVGRDTCKRDSGGPLYIHMLF 238

  Fly   235 VGIV-AYPIGCGCTNIP-----SVYTDVFSGLRWIRHTAYD 269
            .||. |..:|...|...     .:||||...:.:|.....|
  Fly   239 DGIKRATQLGIVSTGTEDCRGFGMYTDVMGHIDFIERIVLD 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13527NP_001286744.1 Tryp_SPc 43..266 CDD:238113 60/231 (26%)
Tryp_SPc 43..263 CDD:214473 59/228 (26%)
CG30091NP_725484.1 Tryp_SPc 36..273 CDD:214473 59/228 (26%)
Tryp_SPc 37..276 CDD:238113 60/231 (26%)
Trypsin 310..520 CDD:278516
Tryp_SPc 313..520 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.