DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13527 and CG43742

DIOPT Version :9

Sequence 1:NP_001286744.1 Gene:CG13527 / 37615 FlyBaseID:FBgn0034776 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_001261130.1 Gene:CG43742 / 14462622 FlyBaseID:FBgn0263999 Length:474 Species:Drosophila melanogaster


Alignment Length:322 Identity:74/322 - (22%)
Similarity:119/322 - (36%) Gaps:103/322 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 CQYVAILITVMVILSGAHRMKRLSSPKFHGDETLELAKYVVSIRSRTPN------------KYFG 57
            |.:.::|:..:||...|.....        ||..:     |.|..|..|            .|..
  Fly     2 CCWFSLLLVAVVIYQNAFAQLL--------DENCK-----VKITYRVANGHTAITSQFMAALYNN 53

  Fly    58 DNHYCGGGLLSNQWVITAAHCVMGQSKIMYKARWLLVVAGSPHRLRYTPGKSVCSPVSSLYVPKN 122
            ...:|||.|:..|:|:||||||....::       .|..|..:|....|   ||..|  |.:...
  Fly    54 SEFFCGGSLIHKQYVLTAAHCVRDLDEV-------TVHLGENNRSCPIP---VCKHV--LRLNAK 106

  Fly   123 FTMHNTF-------NMALMKLQ-----------------EKMPSNDPRIGFLHLPKEAPKIGIRH 163
            ..:|..|       ::||::|:                 |.:.||:..               ..
  Fly   107 VILHPNFHGNIFLNDIALLRLEREVIFEAHIRPICIILDEDVTSNNQN---------------NF 156

  Fly   164 TVLGWGRMYFGGPLAVHIYQVDVVLMDNAVCKTYFRHYGDGMMCAGNNNWTIDAEPCSGDIGSPL 228
            |..|||:...|....|..: :|:|.:..::|     :.....:|||:.:    .:.|..|.|.||
  Fly   157 TAYGWGKTEHGNISDVLSF-IDLVRLPKSMC-----YQNINTICAGSTS----GDTCESDSGGPL 211

  Fly   229 LS-----GK---VVVGIVAYPIGCGCTNIPSVYTDVFSGLRWIRHTAYDWASIT-KTNPTLM 281
            :.     ||   ::.||.:|. ...|:.:..|||||.:...||       ||:. ::.|.|:
  Fly   212 IGNFVHRGKSRDILFGITSYG-DAECSGLFGVYTDVNAYKSWI-------ASVVLESEPRLL 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13527NP_001286744.1 Tryp_SPc 43..266 CDD:238113 63/266 (24%)
Tryp_SPc 43..263 CDD:214473 61/263 (23%)
CG43742NP_001261130.1 Tryp_SPc 34..253 CDD:214473 59/256 (23%)
Tryp_SPc 35..256 CDD:238113 61/265 (23%)
Tryp_SPc 273..467 CDD:214473
Tryp_SPc 273..>368 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.