DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13527 and CG42694

DIOPT Version :9

Sequence 1:NP_001286744.1 Gene:CG13527 / 37615 FlyBaseID:FBgn0034776 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_001188994.1 Gene:CG42694 / 10178792 FlyBaseID:FBgn0261584 Length:512 Species:Drosophila melanogaster


Alignment Length:264 Identity:66/264 - (25%)
Similarity:105/264 - (39%) Gaps:59/264 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 GDNHYCGGGLLSNQWVITAAHCVMGQSKIMYKARWLLVVAG---SPHRLRYTPGKSVCSPVSSLY 118
            |.:..|.|.|:|.|:|::||.|:....|:..:    |.|:.   |||  .||        ||::.
  Fly    53 GTHVLCSGSLISKQFVLSAAQCIDVHGKLFVQ----LGVSNATKSPH--WYT--------VSNVV 103

  Fly   119 VPKNFTMHNTFNMALMKLQEKMPSNDPRIGFLHLP---------KEAPKIGIRHTVLGWGRMYFG 174
            :|.:.......::.|:||.:.:..||    |:: |         .:..||....|...|      
  Fly   104 IPSHSGKRLQRDIGLLKLSQSVDYND----FVY-PICIALNTNTLDMVKILQNFTTSAW------ 157

  Fly   175 GPLAVHIYQVDVVL--MDNAVCKTYFR-HYGDGMMCAG----NNNWTIDAEPCSGD-IGSPLLSG 231
              |:.:.....:||  :....||.... :.....:||.    ||:..||    ||. :..|::.|
  Fly   158 --LSKNKNPQTIVLSQLSRDRCKLNLSGNVTPKEICAASLQRNNSCFID----SGSALTQPIIQG 216

  Fly   232 KVVV-----GIVAYPIGCGCTNIPSVYTDVFSGLRWIRHTA--YDWA-SITKTNPTLMFILLYVL 288
            ..:|     ||..|..|....:.|::|.||...:.||....  ||.. |.....|.:...|.:.|
  Fly   217 SNIVREMLFGIRGYVNGRSWCSEPAIYIDVAECVGWIETVVQQYDGTDSRAVATPEVNQHLKHSL 281

  Fly   289 HRLG 292
            .|:|
  Fly   282 SRMG 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13527NP_001286744.1 Tryp_SPc 43..266 CDD:238113 58/233 (25%)
Tryp_SPc 43..263 CDD:214473 56/230 (24%)
CG42694NP_001188994.1 Tryp_SPc 46..256 CDD:304450 58/233 (25%)
Tryp_SPc 46..253 CDD:214473 56/230 (24%)
Tryp_SPc 319..505 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.