DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42260 and CNBT1

DIOPT Version :9

Sequence 1:NP_001356969.1 Gene:CG42260 / 37614 FlyBaseID:FBgn0259145 Length:1269 Species:Drosophila melanogaster
Sequence 2:NP_566585.1 Gene:CNBT1 / 821037 AraportID:AT3G17700 Length:764 Species:Arabidopsis thaliana


Alignment Length:538 Identity:115/538 - (21%)
Similarity:215/538 - (39%) Gaps:116/538 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   562 AATAARKLHFVFDPAGRLCYYWSMVVSMAFLYNFWV---IIYRFAFQEINRRTIAIW------FC 617
            |::..|.|..:.:|..:....|:...:::.|...::   ..:....||.|:..:..|      ..
plant   182 ASSVNRYLPGIMNPHAKEVQTWTKFFALSCLLAIFIDPLFFFLIKVQEQNKCIMIDWPMTKAFVA 246

  Fly   618 LDYLSDFLYLIDILFHFRTGYLE-------DGVLQTDALKLRTHYMNSTIFYIDCLCLLPL-DFL 674
            :..::|.::.::||..||..|:.       .|.|.:...|:..||:... |::|...::|| ..|
plant   247 VRSVTDVIFTMNILLQFRLAYVARESTVVGAGQLVSHPKKIALHYLKGK-FFLDLFIVMPLPQIL 310

  Fly   675 YLSI--------GFN---SILRS---FRLV-KIYRFWAFMDRTERHTNYPNLFRS---------- 714
            .|.|        |.|   ::||:   |:.: |:||...|: ..:..|.:  :|.|          
plant   311 ILWIIPAHLGASGANYAKNLLRAAVLFQYIPKLYRLLPFL-AGQTPTGF--IFESAWANFVINLL 372

  Fly   715 TALI--H------YLLVIFHWNGCLYH-----------IIHKNNGFGS----RNWVYHDSESADV 756
            |.::  |      ||..:...|.||.:           :|...||..|    ..|  .|:.||:.
plant   373 TFMLAGHVVGSCWYLFGLQRVNQCLRNACGNFGRECQDLIDCGNGNSSVLVRATW--KDNASANA 435

  Fly   757 VKQ------------------------YLQSYYWCTLALTTI-GDLPKPRSKGEYVFVILQLLFG 796
            ..|                        |..|.:|....::|: |:.......||..|.:..:..|
plant   436 CFQEDGFPYGIYLKAVNLTNHSNLFTRYSYSLFWGFQQISTLAGNQVPSYFLGEVFFTMGIIGLG 500

  Fly   797 LMLFATVLGHVANIVTSVSAARKEFQAKLDGVKTYMRMRRVPNHLQVKVIKWFDYLWLTQKCSDE 861
            |:|||.::|::.|.:.::.....|...:...|:.:|..||:|:.::.:|.:...:.|...:..:|
plant   501 LLLFALLIGNMQNFLQALGKRNLEMTLRRRDVEQWMSHRRLPDGIRRRVREAERFNWAATRGVNE 565

  Fly   862 ERAVSCLPDKLKAEIAINVHL-DTLKRVEIFQNTEAGFLCELVLRLRPVLFSPGDYICRKGEVGK 925
            |.....:||.|:.:  |..|| ..||:|.||...:...|..:..||:...:.....:..:|.:.:
plant   566 ELLFENMPDDLQRD--IRRHLFKFLKKVRIFSLMDEPILDAIRERLKQRTYIGSSTVLHRGGLVE 628

  Fly   926 EMYIVNRGRLQVVADNGKTVMASLKAGSYFGEISI---------------LNMGTAGNRRTASVR 975
            :|..:.||.::.:.::|..:  .|..|...||..:               :.|.:.|...:.:||
plant   629 KMVFIVRGEMESIGEDGSVL--PLYEGDVCGEELLTWCLERSSVNPDGTRIRMPSKGLLSSRNVR 691

  Fly   976 SVGYSDLFVLSKKDMWDV 993
            .|...:.|.||..|:.||
plant   692 CVTNVEAFSLSVADLEDV 709

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42260NP_001356969.1 Ion_trans 581..819 CDD:334124 67/327 (20%)
CAP_ED 890..1004 CDD:237999 25/119 (21%)
DUF4655 1084..>1154 CDD:317882
CNBT1NP_566585.1 Ion_trans 205..>391 CDD:395416 39/189 (21%)
CAP_ED 593..709 CDD:237999 23/117 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.