DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42260 and CNGC12

DIOPT Version :9

Sequence 1:NP_001356969.1 Gene:CG42260 / 37614 FlyBaseID:FBgn0259145 Length:1269 Species:Drosophila melanogaster
Sequence 2:NP_001324486.1 Gene:CNGC12 / 819253 AraportID:AT2G46450 Length:649 Species:Arabidopsis thaliana


Alignment Length:538 Identity:122/538 - (22%)
Similarity:212/538 - (39%) Gaps:132/538 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   553 RRTASQRIRAATAARKLHFVFDPAGRL---------CYYWSMVVSMA----------FLYNFWVI 598
            ||:...||.:.....||..|   .|||         ...|...|.:|          ||:...:.
plant     4 RRSKFARIDSMGVDGKLKSV---RGRLKKVYGKMKTLENWRKTVLLACVVALAIDPLFLFIPLID 65

  Fly   599 IYRFAFQEINRRTIAIWFCLDYLSDFLYLIDILFHFRT--------GYLEDGVLQTDALKLRTHY 655
            ..||.| ..::..:|:...:....|..|:|.|:::..|        ..|...::......|:|..
plant    66 SQRFCF-TFDKTLVAVVCVIRTFIDTFYVIHIIYYLITETIAPRSQASLRGEIVVHSKATLKTRL 129

  Fly   656 MNSTIFYIDCLCLLP------LDFLYLSIGFNS-------ILRSF--RLVKIYRFWAFMDR---T 702
            :..  |.:|.:.:||      |..:.||....|       ||..:  |::::|..:..:.|   |
plant   130 LFH--FIVDIISVLPIPQVVVLTLIPLSASLVSERILKWIILSQYVPRIIRMYPLYKEVTRAFGT 192

  Fly   703 ERHTNYP----NLFRSTALIH--------YLLVIFHWNGC--------------LYHIIHKNNG- 740
            ...:.:.    |||  ..::|        ||..|...:.|              :..::.|..| 
plant   193 VAESKWAGAALNLF--LYMLHSYVFGAFWYLSSIERKSKCWRAACARTSDCNLTVTDLLCKRAGS 255

  Fly   741 -------------------------FGSRNWVYHDS--------ESADVVKQYLQSYYWCTLALT 772
                                     ||    :|.|:        :..|..::::..::|....::
plant   256 DNIRFLNTSCPLIDPAQITNSTDFDFG----MYIDALKSGVLEVKPKDFPRKFVYCFWWGLRNIS 316

  Fly   773 TIG-DLPKPRSKGEYVFVILQLLFGLMLFATVLGHVANIVTSVSAARKEFQAKLDGVKTYMRMRR 836
            .:| :|....|.||..|.|:..:.||:|||.::|:|...:.|.:....|.:.|....:.:|..|.
plant   317 ALGQNLETSNSAGEIFFAIIICVSGLLLFAVLIGNVQKYLQSSTTRVDEMEEKRRDTEKWMSYRV 381

  Fly   837 VPNHLQVKVIKWFDYLWLTQKCSDEERAVSCLPDKLKAEIAINVHLDTLKRVEIFQNTEAGFLCE 901
            :|.:|:.::.::.||.|...|.::||..:..||..|:.|....::||.||||......:.|:|.|
plant   382 IPEYLKERIRRFEDYKWRETKGTEEEALLRSLPKDLRLETKRYLYLDMLKRVPWLNIMDDGWLLE 446

  Fly   902 LVL-RLRPVLFSPGDYICRKGEVGKEMYIVNRGRLQVVADNGKTVM------ASLKAGSYFGEIS 959
            .|. |::.|.:....:|.|:|...:||.||.||:|:  :..|...|      ..|:.|...||: 
plant   447 AVCDRVKSVFYLANSFIVREGHPVEEMLIVTRGKLK--STTGSHEMGVRNNCCDLQDGDICGEL- 508

  Fly   960 ILNMGTAGNRRTASVRSV 977
            :.|    |:|...|.|:|
plant   509 LFN----GSRLPTSTRTV 522

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42260NP_001356969.1 Ion_trans 581..819 CDD:334124 62/334 (19%)
CAP_ED 890..1004 CDD:237999 28/95 (29%)
DUF4655 1084..>1154 CDD:317882
CNGC12NP_001324486.1 Ion_trans <302..362 CDD:395416 16/59 (27%)
CAP_ED 435..560 CDD:237999 28/95 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1073751at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.