DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42260 and Cngb3

DIOPT Version :9

Sequence 1:NP_001356969.1 Gene:CG42260 / 37614 FlyBaseID:FBgn0259145 Length:1269 Species:Drosophila melanogaster
Sequence 2:NP_001258167.1 Gene:Cngb3 / 500418 RGDID:1565364 Length:690 Species:Rattus norvegicus


Alignment Length:489 Identity:157/489 - (32%)
Similarity:264/489 - (53%) Gaps:27/489 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   538 SGPGSHGGQPHHQKPRRTASQRIRAATAARKLHFVFDPAGRLCYYWSMVVSMAFLYNFWVIIYRF 602
            |.|..|    ||:..|....:.:|:....|.:....|   |:...|.::|::|:.:|.|::..|.
  Rat   171 SKPKEH----HHKLQRVPVKEYLRSMRLPRSIDSYTD---RIYLLWLLLVTIAYNWNCWLLPVRL 228

  Fly   603 AF--QEINRRTIAIWFCLDYLSDFLYLIDI-LFHFRTGYLEDGVLQTDALKLRTHYMNSTIFYID 664
            .|  |..:.|.  .|...|.:.|.:||.|| |...|..::..|.:..|:.:|:.||.:||.|.:|
  Rat   229 VFPCQTPDNRN--YWIITDIICDIIYLGDILLIQPRLQFVRGGEIIVDSNELKRHYRSSTKFQMD 291

  Fly   665 CLCLLPLDFLYLSIGFNSILRSFRLVKIYRFWAFMDRTERHTNYPNLFRSTALIHYLLVIFHWNG 729
            ...|||.:.||:..|.|.|.|:.|::|...|:.|....|...:...::|......|||.:.|.|.
  Rat   292 VASLLPFEVLYIFFGVNPIFRTNRILKYTSFFEFNHHLESIMDRAYVYRIIRTTGYLLFLLHINA 356

  Fly   730 CLYHIIHKNNGFGSRNWVYHDSESADVVKQYLQSYYWCTLALTTIGDLPKPRSKGEYVFVILQLL 794
            |:|:......|.||..|||:...:     :||:.:||....|.|||.||:|::..|.||.:|...
  Rat   357 CVYYWASDYEGIGSTKWVYNGEGN-----KYLRCFYWAVRTLITIGGLPEPQTSFEIVFQLLNFF 416

  Fly   795 FGLMLFATVLGHVANIVTSVSAARKEFQAKLDGVKTYMRMRRVPNHLQVKVIKWFDYLWLTQKCS 859
            .|:.:|::::|.:.:::.:.:|.:..|...:|.:..||....:|...|.:|..|.:|.|.:|:..
  Rat   417 SGVFVFSSLIGQMRDVIGAATANQNNFHVCMDHIIAYMNKYSIPQSTQHRVRTWLEYTWHSQRIL 481

  Fly   860 DEERAVSCLPDKLKAEIAINVHLDTLKRVEIFQNTEAGFLCELVLRLRPVLFSPGDYICRKGEVG 924
            ||...:..||..::..:||:::.:.:.:||:|:..:...:.:|:|||:..::.|||::|:|||:|
  Rat   482 DESNLLETLPTAMQLSVAIDINFNIIDKVELFKGCDTQMIYDLLLRLKSTIYLPGDFVCKKGEIG 546

  Fly   925 KEMYIVNRGRLQVV-ADNGKTVMASLKAGSYFGEISILNMGTAGNRRTASVRSVGYSDLFVLSKK 988
            |||||:..|.:||: ..:|..|:.:||||:.|||||:|..| .||||||.|.:.|:::|..|.||
  Rat   547 KEMYIIKHGEVQVLGGPDGAQVLVTLKAGAVFGEISLLAKG-GGNRRTADVVAHGFANLLTLDKK 610

  Fly   989 DMWDVLKEYPAARVRLESIAVKRLEKYKKAPLEK 1022
            .:.::|..||.::        |.|.|..|..|.:
  Rat   611 TLQEILLHYPTSK--------KLLMKKAKVLLSQ 636

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42260NP_001356969.1 Ion_trans 581..819 CDD:334124 74/240 (31%)
CAP_ED 890..1004 CDD:237999 49/114 (43%)
DUF4655 1084..>1154 CDD:317882
Cngb3NP_001258167.1 CAP_ED 512..620 CDD:237999 47/108 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1073751at2759
OrthoFinder 1 1.000 - - FOG0000167
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.