DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42260 and CG4839

DIOPT Version :9

Sequence 1:NP_001356969.1 Gene:CG42260 / 37614 FlyBaseID:FBgn0259145 Length:1269 Species:Drosophila melanogaster
Sequence 2:NP_609349.1 Gene:CG4839 / 34348 FlyBaseID:FBgn0032187 Length:1003 Species:Drosophila melanogaster


Alignment Length:224 Identity:47/224 - (20%)
Similarity:86/224 - (38%) Gaps:71/224 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   881 HLDTLKRVEIFQNTEAGFLCELVLRLRPVLFSPGDYICRKGEVGKEMYIVNRGRLQVV---ADNG 942
            :|..|:.....|..:...|.::|..|:...:.....|.|:||:|.|.||:..|.:.:.   ....
  Fly   541 NLQFLRSAPFLQEFDQSLLLKVVDLLQRKFYETDSCIVREGELGNEFYIIRCGTVTIKKLDEQQQ 605

  Fly   943 KTVMASLKAGSYFGEISILNMGTAGNRRTASVRSVGYSD-----LFVLSKKDMWDV------LKE 996
            :.::|:.|.|.||||.::||    .:.|.|||    |:|     :.:|.::.....      |:|
  Fly   606 EQIVANRKRGDYFGEQALLN----ADVRQASV----YADAPGTEVLMLDREAFISYLGTIKQLRE 662

  Fly   997 YPAAR------------------------VRLESIA------------------------VKRLE 1013
            .|:::                        ..|:.||                        :|::|
  Fly   663 KPSSQRNDTSGRSSTKSLEFDNEYSQVAISELKKIATLGCGAFGRVDLVAYNQQALALKIIKKIE 727

  Fly  1014 KYKKAPLEKVKYFNVVAMGRCQSTPGLVE 1042
            ..|:..:|.| |.....|.:|:.:|.:|:
  Fly   728 VVKQDQIEHV-YNEKNVMIKCRQSPFIVQ 755

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42260NP_001356969.1 Ion_trans 581..819 CDD:334124
CAP_ED 890..1004 CDD:237999 32/151 (21%)
DUF4655 1084..>1154 CDD:317882
CG4839NP_609349.1 Crp 428..577 CDD:223736 6/35 (17%)
CAP_ED 431..539 CDD:237999
Crp 544..>650 CDD:223736 30/113 (27%)
CAP_ED 550..663 CDD:237999 30/120 (25%)
S_TKc 695..951 CDD:214567 12/62 (19%)
STKc_cGK 700..957 CDD:270724 10/57 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.