Sequence 1: | NP_001356969.1 | Gene: | CG42260 / 37614 | FlyBaseID: | FBgn0259145 | Length: | 1269 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_609349.1 | Gene: | CG4839 / 34348 | FlyBaseID: | FBgn0032187 | Length: | 1003 | Species: | Drosophila melanogaster |
Alignment Length: | 224 | Identity: | 47/224 - (20%) |
---|---|---|---|
Similarity: | 86/224 - (38%) | Gaps: | 71/224 - (31%) |
- Green bases have known domain annotations that are detailed below.
Fly 881 HLDTLKRVEIFQNTEAGFLCELVLRLRPVLFSPGDYICRKGEVGKEMYIVNRGRLQVV---ADNG 942
Fly 943 KTVMASLKAGSYFGEISILNMGTAGNRRTASVRSVGYSD-----LFVLSKKDMWDV------LKE 996
Fly 997 YPAAR------------------------VRLESIA------------------------VKRLE 1013
Fly 1014 KYKKAPLEKVKYFNVVAMGRCQSTPGLVE 1042 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG42260 | NP_001356969.1 | Ion_trans | 581..819 | CDD:334124 | |
CAP_ED | 890..1004 | CDD:237999 | 32/151 (21%) | ||
DUF4655 | 1084..>1154 | CDD:317882 | |||
CG4839 | NP_609349.1 | Crp | 428..577 | CDD:223736 | 6/35 (17%) |
CAP_ED | 431..539 | CDD:237999 | |||
Crp | 544..>650 | CDD:223736 | 30/113 (27%) | ||
CAP_ED | 550..663 | CDD:237999 | 30/120 (25%) | ||
S_TKc | 695..951 | CDD:214567 | 12/62 (19%) | ||
STKc_cGK | 700..957 | CDD:270724 | 10/57 (18%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |