DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42260 and AgaP_AGAP009798

DIOPT Version :9

Sequence 1:NP_001356969.1 Gene:CG42260 / 37614 FlyBaseID:FBgn0259145 Length:1269 Species:Drosophila melanogaster
Sequence 2:XP_318891.4 Gene:AgaP_AGAP009798 / 1279209 VectorBaseID:AGAP009798 Length:959 Species:Anopheles gambiae


Alignment Length:239 Identity:57/239 - (23%)
Similarity:104/239 - (43%) Gaps:33/239 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   811 VTSVSAARKEFQAKLDGVKTYMRMRRVPNHLQVKVIKWFDYLWLTQ-KCSDEERAVSCLPDKLKA 874
            |:|..:..:|..:|:..:|...:...|.:...:|..|  |.:..|. |..|.|..:       |.
Mosquito   330 VSSQRSLIEELDSKIGTLKKTRKQGVVSDKTDLKESK--DIVIPTHPKSPDTELLI-------KT 385

  Fly   875 EIAINVHLDTLKRVEIFQNTEAGFLCELVLRLRPVLFSPGDYICRKGEVGKEMYIVNRGRLQVVA 939
            .|..|..|:.:...|..|...|.        :..:.|.|..||.::|::|...::...|..:||.
Mosquito   386 AIVANDFLNNMMDEERLQAVTAA--------MSSMTFPPNSYIIKEGDIGAHFFVSEEGTYEVVV 442

  Fly   940 DNGKTVMASLKAGSYFGEISILNMGTAGNRRTASVRSVGYSDLFVLSKKDMWDVL----KEYPAA 1000
            ||  .|:.|...|..|||::||...    :|.||:|....:.:::|.:|....::    ::....
Mosquito   443 DN--KVIKSFGRGVVFGELAILYKA----KRFASIRVTTGARVWLLERKVFQKIMMKSGRKEREE 501

  Fly  1001 RVR-LESIAVKR---LEK-YKKAPLEKVKYFNVVAMGRCQSTPG 1039
            .|| |.:::|.:   :|| :|.:.|.|.:::...:....|..||
Mosquito   502 NVRFLSTVSVLKDLEIEKLHKISDLLKREFYATGSTIIQQGDPG 545

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42260NP_001356969.1 Ion_trans 581..819 CDD:334124 2/7 (29%)
CAP_ED 890..1004 CDD:237999 29/118 (25%)
DUF4655 1084..>1154 CDD:317882
AgaP_AGAP009798XP_318891.4 Crp 387..>533 CDD:223736 40/159 (25%)
CAP_ED 397..494 CDD:237999 28/110 (25%)
Crp 505..>615 CDD:223736 10/41 (24%)
CAP_ED 511..616 CDD:237999 9/35 (26%)
PTZ00263 647..948 CDD:140289
STKc_cGK 657..915 CDD:270724
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.