DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42260 and AgaP_AGAP004940

DIOPT Version :9

Sequence 1:NP_001356969.1 Gene:CG42260 / 37614 FlyBaseID:FBgn0259145 Length:1269 Species:Drosophila melanogaster
Sequence 2:XP_315029.3 Gene:AgaP_AGAP004940 / 1275743 VectorBaseID:AGAP004940 Length:381 Species:Anopheles gambiae


Alignment Length:98 Identity:26/98 - (26%)
Similarity:52/98 - (53%) Gaps:9/98 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   882 LDTLKRVEIFQNTEAGFLCELVLRLRPVLFSPGDYICRKGEVGKEMYIVNRGR--LQVVADNGKT 944
            ||.:..::..||.|...|.:.::   |..::.||.|.::|:....||.:..|:  :::..|.|:.
Mosquito   242 LDAVPMLKTLQNYERMNLADALI---PQTYAKGDRIIKQGDAADGMYFIEDGKVSIRIQQDAGEV 303

  Fly   945 VMASLKAGSYFGEISILNMGTAGNRRTASVRSV 977
            .:::|:.|.||||::::    ....|.||..:|
Mosquito   304 EISNLEKGGYFGELALV----THRPRAASAYAV 332

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG42260NP_001356969.1 Ion_trans 581..819 CDD:334124
CAP_ED 890..1004 CDD:237999 24/90 (27%)
DUF4655 1084..>1154 CDD:317882
AgaP_AGAP004940XP_315029.3 DD_R_PKA 11..49 CDD:295380