DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42260 and hcn5

DIOPT Version :9

Sequence 1:NP_001356969.1 Gene:CG42260 / 37614 FlyBaseID:FBgn0259145 Length:1269 Species:Drosophila melanogaster
Sequence 2:XP_017213269.1 Gene:hcn5 / 101884258 ZFINID:ZDB-GENE-081105-169 Length:305 Species:Danio rerio


Alignment Length:251 Identity:67/251 - (26%)
Similarity:106/251 - (42%) Gaps:42/251 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   572 VFDPAGRL-CYYWSMVVSMAFLYNFWVIIYRFAFQEINRRTIAIWFCLDYLSDFLYLIDILFHFR 635
            |..|..|| .||...:|::.|| |...|....||.:.|  :...|...:..||.|:|||:..:||
Zfish    53 VIHPFSRLRSYYIMCMVAITFL-NLIGIPMEIAFLDGN--SGVGWEGFNVFSDTLFLIDVGVNFR 114

  Fly   636 TGYL----EDGVLQTDALKLRTHYMNSTIFYIDCLCLLPLDFLYL-------------------- 676
            .|.:    |..:|  |...:|..|:.|. |..|.:...|:.::.|                    
Zfish   115 MGIIPEDCERAIL--DLKSIRHRYLKSW-FIPDLVAAFPVGYILLIADLQYHSDSPSSKASKMMR 176

  Fly   677 SIGFNSILRSFRLVKIYRFWAFMDRTERHTNYPNL------FRSTALIHYLLVIFHWNGCLYHII 735
            .:.|..|:...||:::.|...|.:..||.:| .||      .:..:|...:.::.|||||:.:.:
Zfish   177 ILMFVRIISLVRLLRVSRLVRFFNEVERVSN-ANLEVVRVFLKILSLFMMIFLLCHWNGCIQYFV 240

  Fly   736 HKNNGFGSRNWVYHDS-ESADVVKQYLQSYYWCTLALTTI--GDLPKPRSKGEYVF 788
            .....|.|..||..:: .:|.|.::|....:.....:|.|  |....|.|| ||.|
Zfish   241 PMLEEFPSDCWVRRENLMNASVGEKYSFGVFRALSHMTAISYGSSETPTSK-EYTF 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42260NP_001356969.1 Ion_trans 581..819 CDD:334124 63/241 (26%)
CAP_ED 890..1004 CDD:237999
DUF4655 1084..>1154 CDD:317882
hcn5XP_017213269.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.