DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13526 and CALML4

DIOPT Version :9

Sequence 1:NP_611714.1 Gene:CG13526 / 37613 FlyBaseID:FBgn0034774 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_219501.3 Gene:CALML4 / 91860 HGNCID:18445 Length:153 Species:Homo sapiens


Alignment Length:139 Identity:33/139 - (23%)
Similarity:72/139 - (51%) Gaps:0/139 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LTNEHIDELRDAFEKYDLDSNGTLSANEVRLALISVGYEITEAELYDLIHSVAVRDEERLDLKKF 73
            |:.:.|:|.::.|..||....|.:.|.::.:|:..:|...|..|:...:.:..:.....||...|
Human     5 LSQDQINEYKECFSLYDKQQRGKIKATDLMVAMRCLGASPTPGEVQRHLQTHGIDGNGELDFSTF 69

  Fly    74 IRMMAPRMANVDSDKSLCRTFNMIDRDRDGYVTVQDVRAIMVVLGEVVTDDDIKDICQAVDMDGD 138
            :.:|..::...|..|.:.....|:|:::.|||...|:|:.:..|||.:|..::.|:.:..|::.:
Human    70 LTIMHMQIKQEDPKKEILLAMLMVDKEKKGYVMASDLRSKLTSLGEKLTHKEVDDLFREADIEPN 134

  Fly   139 GRISLRDFV 147
            |::...:|:
Human   135 GKVKYDEFI 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13526NP_611714.1 PTZ00184 7..152 CDD:185504 33/139 (24%)
EFh 16..78 CDD:238008 13/61 (21%)
EFh 92..151 CDD:238008 15/56 (27%)
CALML4NP_219501.3 PTZ00184 1..143 CDD:185504 32/137 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23050
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
22.060

Return to query results.
Submit another query.