DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13526 and AT1G62820

DIOPT Version :9

Sequence 1:NP_611714.1 Gene:CG13526 / 37613 FlyBaseID:FBgn0034774 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_176470.1 Gene:AT1G62820 / 842581 AraportID:AT1G62820 Length:148 Species:Arabidopsis thaliana


Alignment Length:150 Identity:41/150 - (27%)
Similarity:81/150 - (54%) Gaps:10/150 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SGNELTNEHIDELRDAFEKYDLDSNGTLSANEVRLALISVGYEITEAELYDLIHSVAVRDEERL- 68
            |.:.|:|:.:..:::||..:|.|.:|.::.:|:.:.:.|:|...||::|..:|.:      |.| 
plant     2 SKDGLSNDQVSSMKEAFMLFDTDGDGKIAPSELGILMRSLGGNPTESQLKSIITT------ENLS 60

  Fly    69 ---DLKKFIRMMAPRMANVDSDKSLCRTFNMIDRDRDGYVTVQDVRAIMVVLGEVVTDDDIKDIC 130
               |..:|:.:||..:.....|:.|...|.::|::..|:|.|.|:|.|:..:||.:...:..:..
plant    61 SPFDFNRFLDLMAKHLKTEPFDRQLRDAFKVLDKEGTGFVAVADLRHILTSIGEKLQPSEFDEWI 125

  Fly   131 QAVDMDGDGRISLRDFVGFM 150
            :.||:..||:|...||:..|
plant   126 KEVDVGSDGKIRYEDFIARM 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13526NP_611714.1 PTZ00184 7..152 CDD:185504 39/147 (27%)
EFh 16..78 CDD:238008 16/65 (25%)
EFh 92..151 CDD:238008 17/58 (29%)
AT1G62820NP_176470.1 PTZ00184 4..148 CDD:185504 39/147 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23050
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.