DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13526 and AT1G12310

DIOPT Version :10

Sequence 1:NP_611714.1 Gene:CG13526 / 37613 FlyBaseID:FBgn0034774 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_172695.1 Gene:AT1G12310 / 837785 AraportID:AT1G12310 Length:148 Species:Arabidopsis thaliana


Alignment Length:146 Identity:40/146 - (27%)
Similarity:80/146 - (54%) Gaps:10/146 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LTNEHIDELRDAFEKYDLDSNGTLSANEVRLALISVGYEITEAELYDLIHSVAVRDEERL----D 69
            |:::.:..:::||..:|.|.:|.::.:|:.:.:.|:|...|:|:|..:|.|      |.|    |
plant     6 LSDDQVSSMKEAFMLFDTDGDGKIAPSELGILMRSLGGNPTQAQLKSIIAS------ENLSSPFD 64

  Fly    70 LKKFIRMMAPRMANVDSDKSLCRTFNMIDRDRDGYVTVQDVRAIMVVLGEVVTDDDIKDICQAVD 134
            ..:|:.:||..:.....|:.|...|.::|::..|:|.|.|:|.|:..:||.:..::..:..:.||
plant    65 FNRFLDLMAKHLKTEPFDRQLRDAFKVLDKEGTGFVAVADLRHILTSIGEKLEPNEFDEWIKEVD 129

  Fly   135 MDGDGRISLRDFVGFM 150
            :..||:|...||:..|
plant   130 VGSDGKIRYEDFIARM 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13526NP_611714.1 PTZ00184 7..152 CDD:185504 40/146 (27%)
AT1G12310NP_172695.1 PTZ00184 4..148 CDD:185504 40/146 (27%)

Return to query results.
Submit another query.