DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13526 and CAM6

DIOPT Version :9

Sequence 1:NP_611714.1 Gene:CG13526 / 37613 FlyBaseID:FBgn0034774 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_850860.1 Gene:CAM6 / 832245 AraportID:AT5G21274 Length:149 Species:Arabidopsis thaliana


Alignment Length:144 Identity:47/144 - (32%)
Similarity:92/144 - (63%) Gaps:0/144 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 NELTNEHIDELRDAFEKYDLDSNGTLSANEVRLALISVGYEITEAELYDLIHSVAVRDEERLDLK 71
            ::||::.|.|.::||..:|.|.:|.::..|:...:.|:|...|||||.|:|:.|.......:|..
plant     3 DQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFP 67

  Fly    72 KFIRMMAPRMANVDSDKSLCRTFNMIDRDRDGYVTVQDVRAIMVVLGEVVTDDDIKDICQAVDMD 136
            :|:.:||.:|.:.||::.|...|.:.|:|::|:::..::|.:|..|||.::|:::.::.:..|:|
plant    68 EFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLSDEEVDEMIREADVD 132

  Fly   137 GDGRISLRDFVGFM 150
            |||:|:..:||..|
plant   133 GDGQINYEEFVKVM 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13526NP_611714.1 PTZ00184 7..152 CDD:185504 47/144 (33%)
EFh 16..78 CDD:238008 19/61 (31%)
EFh 92..151 CDD:238008 19/59 (32%)
CAM6NP_850860.1 PTZ00184 1..149 CDD:185504 47/144 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.870

Return to query results.
Submit another query.