DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13526 and AT3G10190

DIOPT Version :9

Sequence 1:NP_611714.1 Gene:CG13526 / 37613 FlyBaseID:FBgn0034774 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_187630.1 Gene:AT3G10190 / 820181 AraportID:AT3G10190 Length:209 Species:Arabidopsis thaliana


Alignment Length:140 Identity:39/140 - (27%)
Similarity:70/140 - (50%) Gaps:9/140 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 ELRDAFEKYDLDSNGTLSANEVRLALISVGYE-ITEAELYDLIHSVAVRDEERLDLKKFIRMMAP 79
            |:..||:..|.|::|.:|.:::...|..:|.: :||.|:..::..|....:..:.|::    :|.
plant    70 EILQAFKLIDRDNDGAVSRHDLESLLSRLGPDPLTEEEINVMLKEVDCDGDGTIRLEE----LAS 130

  Fly    80 RMANVD---SDKSLCRTFNMIDRDRDGYVTVQDVRAIMVVLG-EVVTDDDIKDICQAVDMDGDGR 140
            |:.::|   ....|..||...|.||||.::..::..:...:| |..|.||.|.:...||.||||.
plant   131 RVVSLDPARDSTELKETFEFFDADRDGLISADELLRVFSTIGDERCTLDDCKRMIADVDEDGDGF 195

  Fly   141 ISLRDFVGFM 150
            :...:|...|
plant   196 VCFTEFSRMM 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13526NP_611714.1 PTZ00184 7..152 CDD:185504 39/140 (28%)
EFh 16..78 CDD:238008 14/62 (23%)
EFh 92..151 CDD:238008 21/60 (35%)
AT3G10190NP_187630.1 EFh 70..132 CDD:238008 15/65 (23%)
EF-hand_7 71..129 CDD:290234 13/61 (21%)
EFh 143..205 CDD:238008 21/61 (34%)
EF-hand_7 144..205 CDD:290234 21/60 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1435392at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.