DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13526 and AT2G41410

DIOPT Version :9

Sequence 1:NP_611714.1 Gene:CG13526 / 37613 FlyBaseID:FBgn0034774 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_181672.1 Gene:AT2G41410 / 818739 AraportID:AT2G41410 Length:216 Species:Arabidopsis thaliana


Alignment Length:165 Identity:43/165 - (26%)
Similarity:72/165 - (43%) Gaps:32/165 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPSFSGNELTNEHIDELRDAFEKYDLDSNGTLSANEVRLALISVGYEITEAELYDLIHSVAVRDE 65
            :|..||:..|     ||..||:..|.|.:|.:|..:: .||||           .|.|....::|
plant    60 LPQNSGDFYT-----ELVQAFKLIDRDDDGVVSRGDL-AALIS-----------RLSHEPPSQEE 107

  Fly    66 ERLDLKKF---------IRMMAPRMANVDSDKS-----LCRTFNMIDRDRDGYVTVQDVRAIMVV 116
            ..|.|::.         :..:|.|:|....:.|     |...|.:.|.||:|.::.:::..:..|
plant   108 VSLMLREVDGGDGGCISLEDLASRVAGTSGEGSVETEELREVFEIFDVDRNGKISAEELHRVFGV 172

  Fly   117 LG-EVVTDDDIKDICQAVDMDGDGRISLRDFVGFM 150
            :| |..|.::...:...||.:|||.:...||...|
plant   173 IGDERCTLEECMRMIATVDGNGDGFVCFDDFCRMM 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13526NP_611714.1 PTZ00184 7..152 CDD:185504 40/159 (25%)
EFh 16..78 CDD:238008 17/70 (24%)
EFh 92..151 CDD:238008 17/60 (28%)
AT2G41410NP_181672.1 PTZ00184 70..208 CDD:185504 39/150 (26%)
EFh 70..133 CDD:238008 19/74 (26%)
EFh 145..207 CDD:238008 17/61 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1435392at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.