DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13526 and Efcab2

DIOPT Version :9

Sequence 1:NP_611714.1 Gene:CG13526 / 37613 FlyBaseID:FBgn0034774 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_080902.1 Gene:Efcab2 / 68226 MGIID:1915476 Length:164 Species:Mus musculus


Alignment Length:142 Identity:38/142 - (26%)
Similarity:72/142 - (50%) Gaps:9/142 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 ELRDAFEKYDLDSNGTLSANEVRLALISVGYEITEAELYDLIHSVAVRDEE---RLDLKKFI--- 74
            :::||||.:|.:||.|:...|:...:.|:|...||.||:|.|  ..:.:||   .:..:|||   
Mouse    20 KIKDAFEVFDHESNNTVDVREIGTIIRSLGCCPTEGELHDFI--AEIEEEEPTGYIRFEKFIPVM 82

  Fly    75 -RMMAPRMANVDSDKSLCRTFNMIDRDRDGYVTVQDVRAIMVVLGEVVTDDDIKDICQAVDMDGD 138
             |.:..|.....::..|.|.|.::|..:.|::|..::...|...||..:.::::::..|......
Mouse    83 TRALVERRYRPAAEDILLRAFEVLDPAKRGFLTKDELVKYMTEEGEPFSQEEMEEMLSAAIDPES 147

  Fly   139 GRISLRDFVGFM 150
            ..|:.||::..|
Mouse   148 NTINYRDYITMM 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13526NP_611714.1 PTZ00184 7..152 CDD:185504 38/142 (27%)
EFh 16..78 CDD:238008 23/68 (34%)
EFh 92..151 CDD:238008 13/59 (22%)
Efcab2NP_080902.1 PTZ00184 10..160 CDD:185504 38/142 (27%)
EFh 20..83 CDD:298682 22/64 (34%)
EFh 99..159 CDD:298682 13/59 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.