powered by:
Protein Alignment CG13526 and MYL7
DIOPT Version :9
Sequence 1: | NP_611714.1 |
Gene: | CG13526 / 37613 |
FlyBaseID: | FBgn0034774 |
Length: | 154 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_011513765.1 |
Gene: | MYL7 / 58498 |
HGNCID: | 21719 |
Length: | 231 |
Species: | Homo sapiens |
Alignment Length: | 56 |
Identity: | 17/56 - (30%) |
Similarity: | 30/56 - (53%) |
Gaps: | 3/56 - (5%) |
- Green bases have known domain annotations that are detailed below.
Fly 92 RTFNMIDRDRDGYVTVQDVRAIMVVLGEVVTDDDIKDICQAVDMDGDGRISLRDFV 147
:.|:.||::|||.:...|:|.....||:|...::..| |:..:|.|.|:...|:
Human 62 QAFSCIDQNRDGIICKADLRETYSQLGKVSVPEEELD---AMLQEGKGPINFTVFL 114
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1435392at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.010 |
|
Return to query results.
Submit another query.