DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13526 and cabp2a

DIOPT Version :9

Sequence 1:NP_611714.1 Gene:CG13526 / 37613 FlyBaseID:FBgn0034774 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_001025439.2 Gene:cabp2a / 572226 ZFINID:ZDB-GENE-050913-25 Length:236 Species:Danio rerio


Alignment Length:148 Identity:45/148 - (30%)
Similarity:83/148 - (56%) Gaps:8/148 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 ELTNEHIDELRDAFEKYDLDSNGTLSANEVRLALISVGYEITEAELYDLIHSVAVRDEERLDLKK 72
            :|..|.|:||::||.::|.|.:|.:|..::...:.::||..||.||.:|...:.   ..|:|.:.
Zfish    90 DLRPEEIEELKEAFREFDKDKDGFISCKDLGECMRTMGYMPTEMELIELSQQIC---GGRVDFED 151

  Fly    73 FIRMMAPRMANVDSD----KSLCRTFNMIDRDRDGYVTVQDVR-AIMVVLGEVVTDDDIKDICQA 132
            |:.:|.|:|....:|    |.|...|...|.:.||.:::.::| |:..::||.:...:|.:|.:.
Zfish   152 FVDLMGPKMLAETADMIGVKELRDAFREFDSNGDGQISLAELREAMKKLMGEQLNHREIDEILRD 216

  Fly   133 VDMDGDGRISLRDFVGFM 150
            ||::|||.:...:||..|
Zfish   217 VDLNGDGLVDFEEFVRMM 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13526NP_611714.1 PTZ00184 7..152 CDD:185504 45/148 (30%)
EFh 16..78 CDD:238008 18/61 (30%)
EFh 92..151 CDD:238008 18/60 (30%)
cabp2aNP_001025439.2 PTZ00184 91..234 CDD:185504 44/145 (30%)
EFh 98..198 CDD:238008 30/102 (29%)
EFh 172..235 CDD:238008 19/63 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170576563
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.