DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13526 and CALML5

DIOPT Version :9

Sequence 1:NP_611714.1 Gene:CG13526 / 37613 FlyBaseID:FBgn0034774 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_059118.2 Gene:CALML5 / 51806 HGNCID:18180 Length:146 Species:Homo sapiens


Alignment Length:139 Identity:42/139 - (30%)
Similarity:74/139 - (53%) Gaps:3/139 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 ELTNEHIDELRDAFEKYDLDSNGTLSANEVRLALISVGYEITEAELYDLIHSVAVRDEERLDLKK 72
            |||.|...:.:.||...|.|.|||::|.|:..||.:.|..::||:|..||..|....:..:..::
Human     4 ELTPEEEAQYKKAFSAVDTDGNGTINAQELGAALKATGKNLSEAQLRKLISEVDSDGDGEISFQE 68

  Fly    73 FIRMMAPRMANVDSDKSLCRTFNMIDRDRDGYVTVQDVRAIMVVLGEVVTDDDIKDICQAVDMDG 137
            |:.......|.::   .|...|...|:|.||::||.::|..|..||:.:..:::..:.:..|:|.
Human    69 FLTAAKKARAGLE---DLQVAFRAFDQDGDGHITVDELRRAMAGLGQPLPQEELDAMIREADVDQ 130

  Fly   138 DGRISLRDF 146
            |||::..:|
Human   131 DGRVNYEEF 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13526NP_611714.1 PTZ00184 7..152 CDD:185504 42/139 (30%)
EFh 16..78 CDD:238008 19/61 (31%)
EFh 92..151 CDD:238008 17/55 (31%)
CALML5NP_059118.2 PTZ00184 1..143 CDD:185504 42/139 (30%)
EFh 12..74 CDD:238008 19/61 (31%)
EFh 82..144 CDD:238008 18/58 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23050
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
32.970

Return to query results.
Submit another query.