DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13526 and Myl10

DIOPT Version :9

Sequence 1:NP_611714.1 Gene:CG13526 / 37613 FlyBaseID:FBgn0034774 Length:154 Species:Drosophila melanogaster
Sequence 2:XP_038945819.1 Gene:Myl10 / 501831 RGDID:1561258 Length:167 Species:Rattus norvegicus


Alignment Length:142 Identity:23/142 - (16%)
Similarity:60/142 - (42%) Gaps:23/142 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 IDELRDAFEKYDLDSNGTLSANEVRLALISVGYEITEAELYDLIHSVAVRDEE----------RL 68
            |.|.::||...|.:.:|.:...::|....::|             .:.|::||          .:
  Rat    27 IQEFKEAFTIMDQNRDGFIDKEDLRDTFAALG-------------RINVKNEELEAMVKEAPGPI 78

  Fly    69 DLKKFIRMMAPRMANVDSDKSLCRTFNMIDRDRDGYVTVQDVRAIMVVLGEVVTDDDIKDICQAV 133
            :...|:.|...::...|.::::...|.:.|.:..|:|....::..::...:..:::::|.:..|.
  Rat    79 NFTVFLTMFGEKLKGTDPEETILHAFKVFDTEGKGFVKADFIKEKLMTQADRFSEEEVKQMFAAF 143

  Fly   134 DMDGDGRISLRD 145
            ..|..|.:..|:
  Rat   144 PPDVCGNLDYRN 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13526NP_611714.1 PTZ00184 7..152 CDD:185504 23/142 (16%)
EFh 16..78 CDD:238008 12/71 (17%)
EFh 92..151 CDD:238008 9/54 (17%)
Myl10XP_038945819.1 FRQ1 15..164 CDD:227455 23/142 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1435392at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.